Learn More
ATP5E, Mouse, Clone: 2F3, Abnova™
Mouse monoclonal antibody raised against a full-length recombinant ATP5E.
Supplier: Abnova Corporation H00000514M01
Description
This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the epsilon subunit of the catalytic core. Two pseudogenes of this gene are located on chromosomes 4 and 13. [provided by RefSeq
Sequence: MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE- Environmental benefits include:
- Recyclable
Specifications
ATP5E | |
Monoclonal | |
Unconjugated | |
PBS with no preservative; pH 7.4 | |
BC001690 | |
ATP5E | |
ATP5E (AAH01690, 1 a.a. ∼ 51 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | |
100 μg | |
Primary | |
Human | |
Antibody | |
IgG1 κ |
ELISA, Immunohistochemistry (PFA fixed), Western Blot | |
2F3 | |
Mouse monoclonal antibody raised against a full length recombinant ATP5E. | |
ATP5E | |
ATPE/MGC104243 | |
Mouse | |
Affinity chromatography | |
RUO | |
514 | |
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | |
Liquid |