Learn More
ATOX1 (M09), Mouse anti-Human, Clone: 3A1, Abnova™
Mouse monoclonal antibody raised against a partial recombinant ATOX1.
Supplier: Abnova Corporation H00000475M09
Description
This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome. [provided by RefSeq
Sequence: MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE- Environmental benefits include:
- Renewable Energy
Specifications
ATOX1 | |
Monoclonal | |
Unconjugated | |
PBS with no preservative; pH 7.4 | |
NM_004045 | |
ATOX1 | |
ATOX1 (NP_004036, 1 a.a. ∼ 68 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | |
50 μg | |
Primary | |
Human | |
Antibody | |
IgG2b κ |
ELISA, Immunofluorescence, Western Blot | |
3A1 | |
Mouse monoclonal antibody raised against a partial recombinant ATOX1. | |
ATOX1 | |
ATX1/HAH1/MGC138453/MGC138455 | |
Mouse | |
Affinity chromatography | |
RUO | |
475 | |
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | |
Liquid |