Learn More
ASCL1, Mouse, Clone: 7E11, Abnova™
Mouse monoclonal antibody raised against a partial recombinant ASCL1.
Supplier: Abnova Corporation H00000429M01
Description
This gene encodes a member of the basic helix-loop-helix (BHLH) family of transcription factors. The protein activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. This protein plays a role in the neuronal commitment and differentiation and in the generation of olfactory and autonomic neurons. Mutations in this gene may contribute to the congenital central hypoventilation syndrome (CCHS) phenotype in rare cases. [provided by RefSeq]
Sequence: GFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF- Environmental benefits include:
- Renewable Energy
Specifications
ASCL1 | |
Monoclonal | |
Unconjugated | |
PBS with no preservative; pH 7.4 | |
NM_004316 | |
ASCL1 | |
ASCL1 (NP_004307, 137 a.a. ∼ 236 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | |
100 μg | |
Primary | |
Human | |
Antibody | |
IgG2a κ |
ELISA, Western Blot | |
7E11 | |
Mouse monoclonal antibody raised against a partial recombinant ASCL1. | |
ASCL1 | |
ASH1/HASH1/MASH1/bHLHa46 | |
Mouse | |
Affinity chromatography | |
RUO | |
429 | |
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | |
Liquid |