Recombinant Proteins
Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
Form
- (1)
- (1)
- (23,210)
- (5,052)
- (29)
- (22)
- (26)
- (35)
For Use With (Application)
- (2)
- (79)
- (3)
- (1)
- (1)
- (8)
- (271)
- (3)
- (21,575)
- (1)
- (1)
- (2)
- (6)
- (44)
- (2)
- (2)
- (2)
- (2)
- (1)
- (2)
- (3)
- (1)
- (1)
- (3)
- (5)
- (10)
- (21,933)
- (1)
- (2)
- (1)
- (1)
- (2,082)
- (4)
- (1)
- (8)
- (2)
- (1)
- (8)
- (1)
- (1)
- (1)
- (8)
- (4,503)
- (134)
- (1)
- (1)
- (4)
- (1)
- (20)
- (3)
- (23)
- (27)
- (5)
- (2)
- (13)
- (1)
- (1,227)
- (2)
- (18)
- (26)
- (1)
- (2)
- (1)
- (18)
- (2)
- (2)
- (1)
- (4)
- (1)
- (7)
- (1)
- (1)
- (3)
- (1)
- (1)
- (64)
- (3)
- (6)
- (1)
- (1)
- (6)
- (7)
- (5)
- (1)
- (1)
- (7)
- (6)
- (3)
- (14)
- (2)
- (4)
- (4)
- (6)
- (1)
- (2,065)
- (14)
- (1)
- (1)
Recombinant
- (69)
- (28,240)
Conjugate
- (11)
- (1)
- (4)
- (2)
- (9)
- (7)
- (1)
- (7)
- (1)
- (3)
- (1)
- (1)
- (2)
- (1)
- (4)
- (8)
- (2)
- (1)
- (13)
- (5)
- (1)
- (2)
- (3)
- (27,955)
Species
- (1)
- (9)
- (25)
- (2)
- (1)
- (280)
- (23,130)
- (2)
- (101)
- (1)
- (2)
- (1)
- (1)
- (4)
- (8)
- (3)
- (179)
- (15)
Showing products from the Recombinant Proteins category.
View All Search Results
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
1
–
15
of
24,492
results
| Regulatory Status | RUO |
|---|---|
| Preparation Method | Dilute alkaline solutions (1mg/mL) |
| Form | Solid |
| Immunogen | Casein |
| Storage Requirements | Following reconstitution, aliquot and freeze (−20°C). Stock solutions are stable for up to 3 months at −20°C. |
| Species | Bovine |
| Recombinant | Native |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | ADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHS |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human LIS1 (aa 16-161) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human SLC7A5 (aa 16-50) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purification Method | Assay |
| Preparation Method | Dilute Alkaline Solutions (10mg/mL) |
| Purity or Quality Grade | ≥95% |
| Form | Solid |
| Without Additives | Carbohydrate and Fatty Acid Free |
| Immunogen | Casein |
| Storage Requirements | Following reconstitution, store in the refrigerator (4°C). Stock solutions are stable for up to 1 week at 4°C. After one week, it is recommended that fresh solution be prepared. |
| Species | Bovine |
| Recombinant | Native |
| Purity or Quality Grade | Affinity chromatography |
|---|---|
| Conjugate | Unconjugated |
| Specific Reactivity | Human |
| Form | Lyophilized |
| pH Range | 3.0 |
| Common Name | Human IL-34 Carrier-Free |
| Molecular Weight (g/mol) | 52.5kDa |
| Gene Symbol | IL34 |
| Endotoxin Concentration | Less than 0.1ng/μg cytokine as determined by the LAL assay |
| Storage Requirements | -20°C |
| Protein Subtype | Recombinant |
| Name | Human IL-34 Carrier-Free |
| Accession Number | Q6ZMJ4 |
| Regulatory Status | RUO |
| Purification Method | SDS-PAGE and HPLC |
| Product Type | Recombinant Protein, Carrier-Free |
| Biological Activity | The activity of this protein was determined by measuring MCP-1 secretion from normal human peripheral blood cells. |
| Gene ID (Entrez) | 146433 |
| Formulation | 0.02M citric acid with no preservative; pH 3.0 |
| Structural Form | HEK 293 cells (amino acids Asn21-Pro242; Accession # NP_001166243); contains a C-terminal 8X His tag |
| Shelf Life | 12 Months |
| Cross Reactivity | Hu |
| Species | Human (HEK293) |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | PLENEPKEMLTLSEYHERVRSQGQQLQQLQAELDKLHKEVSTVRAANSERVAKLVFQRLNEDFVRKPDYALSSVGASIDLQKTSHDYAD |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human SPAG4 (aa 191-279) Control Fragment |
| Recombinant | Recombinant |