missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP100819

Invitrogen™ Human CRB2 (aa 720-802) Control Fragment Recombinant Protein

Numéro de catalogue. RP100819
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP100819 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP100819 Fournisseur Invitrogen™ Code fournisseur RP100819
Il en reste null

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60462 (PA5-60462. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CRB2 (Crumbs homolog 2), like its homologs CRB1 and CRB3, is similar to the Drosophila crumbs protein and is expressed in retina, brain and kidney. Along with other proteins, the Crumbs proteins form a complex that help set up cell polarity in developing neuroepithelial cells. At the onset of neural specification, embryonic stem cells (ESCs) upregulate CRB2, which then localizes apically in neural rosettes. Gain- and loss-of-function studies of CRB2 have shown that CRB2 is essential for the stabilization of other polarity proteins. Unlike CRB1, mutations in CRB2 do not appear to play a role in retinitis pigmentosa or in Leber congenital amaurosis.

Spécifications

Accession Number Q5IJ48
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 286204
Name Human CRB2 (aa 720-802) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5930402A21; BC043114; Crb2; crumbs 2; crumbs 2, cell polarity complex component; crumbs family member 2; crumbs homolog 2; crumbs2; crumbs-like protein 2; FSGS9; Protein crumbs homolog 2; RGD1309368; VMCKD
Common Name CRB2
Gene Symbol CRB2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RWDDGLRHLVMLSFGPDQLQDLGQHVHVGGRLLAADSQPWGGPFRGCLQDLRLDGCHLPFFPLPLDNSSQPSELGGRQSWNLT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats