missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP90445

Invitrogen™ Human ZNF258 (aa 3-145) Control Fragment Recombinant Protein

Catalog No. RP90445
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90445 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90445 Supplier Invitrogen™ Supplier No. RP90445
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52770 (PA5-52770. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZNF258 is part of a novel, putative, zinc-binding motif (MYM) family which encodes proteins that maintain the repeats of the MYM motif.

Specifications

Accession Number O95789
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9204
Name Human ZNF258 (aa 3-145) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Buster2; KIAA1353; MYM; transposase-like protein; transposon-derived Buster2 transposase-like protein; ZBED7; zinc finger MYM-type containing 6; zinc finger MYM-type protein 6; Zinc finger protein 258; zinc finger, BED-type containing 7; zinc finger, MYM-type 6; zinc finger, MYM-type containing 6; ZMYM6; ZNF198L4; ZNF258
Common Name ZNF258
Gene Symbol ZMYM6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EPLDGECGKAVVPQQELLDKIKEEPDNAQEYGCVQQPKTQESKLKIGGVSSVNERPIAQQLNPGFQLSFASSGPSVLLPSVPAVAIKVFCSGCKKMLYKGQTAYHKTGSTQLFCSTRCITRHSSPACLPPPPKKTCTNCSKYK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less