missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP96322

Invitrogen™ Human EHHADH (aa 153-248) Control Fragment Recombinant Protein

Numéro de catalogue. RP96322
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP96322 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP96322 Fournisseur Invitrogen™ Code fournisseur RP96322
Il en reste null

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83334 (PA5-83334. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

As an L-hydroxy-specific enzyme, EHHADH (enoyl-CoA-hydratase:3-hydroxyacyl-CoA dehydrogenase), also known as Peroxisomal L-bifunctional enzyme, is a 723 amino acid protein has an essential tripeptide sequence on its carboxyl-terminus that is required for peroxisomal transport. EHHADH-null mice only exhibit a blunted peroxisome proliferative response when challenged with a peroxisome proliferator. Since there were no observed changes in lipid metabolism, this evidence suggests that enoyl-CoAs were diverted to the D-hydroxy-specific beta-oxidation system for metabolism.

Spécifications

Accession Number Q08426
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1962
Name Human EHHADH (aa 153-248) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1; 1300002P22Rik; 3,2-trans-enoyl-CoA isomerase; 3-hydroxyacyl-CoA dehydrogenase; ECHD; EHHADH; Enoyl-CoA hydratase/3,2-trans-enoyl-CoA isomerase; enoyl-CoA, hydratase/3-hydroxyacyl CoA dehydrogenase; enoyl-Coenzyme A, hydratase/3-hydroxyacyl Coenzyme A dehydrogenase; FRTS3; HD; L-3-hydroxyacyl-CoA dehydrogenase; LBFP; L-bifunctional enzyme; L-bifunctional protein, peroxisomal; Lbp; L-PBE; L-specific bifunctional protein; L-specific multifunctional beta-oxdiation protein; MEF; Mfe; Mfe1; MFP; MFP1; multifunctional enzyme type 1; Pbe; PBFE; perMFE-1; Peroxisomal bifunctional enzyme; peroxisomal bifunctional enzyme type 1; peroxisomal enoyl-CoA hydratase
Common Name EHHADH
Gene Symbol EHHADH
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TSGRRILADEALKLGILDKVVNSDPVEEAIRFAQRVSDQPLESRRLCNKPIQSLPNMDSIFSEALLKMRRQHPGCLAQEACVRAVQAAVQYPYEVG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats