missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP106670

Invitrogen™ Human HMBOX1 (aa 337-419) Control Fragment Recombinant Protein

Catalog No. RP106670
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP106670 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP106670 Supplier Invitrogen™ Supplier No. RP106670
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65983 (PA5-65983. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HMBOX1 is located at the boundary of 8p12.3 and 8p21.1. HMBOX1 proteins are highly conserved in human, mouse, rat, chicken and Xenopus laevis. Functional HMBOX1::EGFP (enhanced green fluorescent protein) fusion protein revealed that HMBOX1 accumulated more in cytoplasm than in nucleus. HMBOX1 is a transcription repressor. Human HMBOX1 is widely expressed in 18 tissues, and it is highly expressed in pancreas. Hmbox1 is widely expressed in mouse pancreas and the expression of this gene can also be detected in pallium, hippocampus and hypothalamus.

Specifications

Accession Number Q6NT76
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79618
Name Human HMBOX1 (aa 337-419) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI451877; AI604847; F830020C16Rik; HMBOX1; HNF1LA; homeobox containing 1; homeobox telomere-binding protein 1; Homeobox-containing protein 1; homeobox-containing protein PBHNF; HOT1; PBHNF; RGD1306787; TAH1; Telomere-associated homeobox-containing protein 1
Common Name HMBOX1
Gene Symbol HMBOX1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IKRRANIEAAILESHGIDVQSPGGHSNSDDVDGNDYSEQDDSTSHSDHQDPISLAVEMAAVNHTILALARQGANEIKTEALDD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less