missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP89679

Invitrogen™ Human HECW1 (aa 356-481) Control Fragment Recombinant Protein

Catalog No. RP89679
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89679 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89679 Supplier Invitrogen™ Supplier No. RP89679
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (45%), Rat (45%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-64914 (PA5-64914, PA5-52457 (PA5-52457. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent degradation of DVL1. Also targets the mutant SOD1 protein involved in familial amyotrophic lateral sclerosis (FALS). Forms cytotoxic aggregates with DVL1, SSR3 and mutant SOD1 that lead to motor neuron death in FALS.

Specifications

Accession Number Q76N89
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23072
Name Human HECW1 (aa 356-481) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias E3 ubiquitin-protein ligase HECW1; HECT type E3 ubiquitin ligase; HECT, C2 and WW domain containing E3 ubiquitin protein ligase 1; HECT, C2 and WW domain-containing protein 1; HECT-type E3 ubiquitin transferase HECW1; HECW1; hNEDL1; KIAA0322; NEDD4-like E3 ubiquitin-protein ligase 1; NEDD4-like ubiquitin-protein ligase 1; NEDL1; RGD1561038
Common Name HECW1
Gene Symbol HECW1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence STEPESAQIQDSPMNNLMESGSGEPRSEAPESSESWKPEQLGEGSVPDGPGNQSIELSRPAEEAAVITEAGDQGMVSVGPEGAGELLAQVQKDIQPAPSAEELAEQLDLGEEASALLLEDGEAPAS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less