missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP103973

Invitrogen™ Human UBE2L3 (aa 86-154) Control Fragment Recombinant Protein

Catalog No. RP103973
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP103973 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP103973 Supplier Invitrogen™ Supplier No. RP103973
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111547 (PA5-111547. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). UBE2L3 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is demonstrated to participate in the ubiquitination of p53, c-Fos, and the NF-kB precursor p105 in vitro.

Specifications

Accession Number P68036
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7332
Name Human UBE2L3 (aa 86-154) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C79827; E2 ubiquitin-conjugating enzyme L3; E2-F1; L-UBC; UBCE7; UBCH7; UbcM4; Ube2l3; Ubiquitin carrier protein L3; ubiquitin conjugating enzyme E2 L3; ubiquitin conjugating enzyme E2L 3; ubiquitin-conjugating enzyme 7; ubiquitin-conjugating enzyme E2 L3; Ubiquitin-conjugating enzyme E2-F1; ubiquitin-conjugating enzyme E2L 3; ubiquitin-conjugating enzyme UBCH7; ubiquitin-protein ligase L3; Unknown (protein for MGC:127956)
Common Name UBE2L3
Gene Symbol UBE2L3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence CLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less