missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP102493

Invitrogen™ Human HOXA6 (aa 27-136) Control Fragment Recombinant Protein

Catalog No. RP102493
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP102493 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP102493 Supplier Invitrogen™ Supplier No. RP102493
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82146 (PA5-82146. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation.

Specifications

Accession Number P31267
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3203
Name Human HOXA6 (aa 27-136) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias homeo box 1 B; homeo box A6; homeobox A6; homeobox protein Hox-1.2; Homeobox protein Hox-1 B; homeobox protein HOXA6; homeobox protein Hox-A6; homeobox protein M5-4; HO x 1; HO x 1.2; Hox-1.2; HO x 1 B; Hoxa6; Hoxa-6
Common Name HOXA6
Gene Symbol HOXA6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LYQAGYDALRPFPASYGASSLPDKTYTSPCFYQQSNSVLACNRASYEYGASCFYSDKDLSGASPSGSGKQRGPGDYLHFSPEQQYKPDSSSGQGKALHDEGADRKYTSPV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less