accessibility menu, dialog, popup

UserName

Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
Forme 
  • (1)
  • (1)
  • (23,210)
  • (5,054)
  • (29)
  • (22)
  • (26)
  • (35)
À utiliser avec (application) 
  • (2)
  • (79)
  • (3)
  • (1)
  • (1)
  • (88)
  • (630)
  • (3)
Recombinant 
  • (69)
  • (28,242)
Conjugué 
  • (11)
  • (1)
  • (4)
  • (2)
  • (9)
  • (7)
  • (1)
  • (7)
Espèces 
  • (2)
  • (5)
  • (29)
  • (2)
  • (1)
  • (273)
  • (23,146)
  • (2)

Résultats de la recherche filtrée

Les produits de certains de nos fournisseurs ne s'affichent pas dans les résultats de la recherche filtrée. Veuillez supprimer tous les filtres pour voir ces produits.

Affiner les résultats

Affiner les résultats

Aucun résultat trouvé dans cette catégorie. Essayez de supprimer certains filtres sélectionnés et réessayez.

catégorie

offres spéciales

  • (1)

marques

  • (327)
  • (3)
  • (20,921)
  • (6)
  • (275)
  • (383)
  • (81)
  • (2)
  • (277)
  • (435)
  • (3)
  • (1)
  • (2)
  • (6,722)
  • (1)

intérêts particuliers

  • (2)

Forme

  • (1)
  • (1)
  • (23,210)
  • (5,054)
  • (29)
  • (22)
  • (26)
Afficher tous

À utiliser avec (application)

  • (2)
  • (79)
  • (3)
  • (1)
  • (1)
  • (88)
  • (630)
Afficher tous

Recombinant

  • (69)
  • (28,242)

Conjugué

  • (11)
  • (1)
  • (4)
  • (2)
  • (9)
  • (7)
  • (1)
Afficher tous

Espèces

  • (2)
  • (5)
  • (29)
  • (2)
  • (1)
  • (273)
  • (23,146)
Afficher tous

Format du kit d’immunoessai

  • (10)

Espèces cibles

  • (2)
  • (3)
  • (5)

Méthode de détection

  • (1)

Substrate Properties

  • (1)

Type de substrat

  • (1)
1 – 15 de 24,492 résultats
1

MilliporeSigma™ Casein, Bovine Milk, Protein

État réglementaire RUO
Méthode de préparation Dilute alkaline solutions (1mg/mL)
Conditions de stockage Following reconstitution, aliquot and freeze (−20°C). Stock solutions are stable for up to 3 months at −20°C.
Immunogène Casein
Espèces Bovine
Forme Solid
Recombinant Native
5

Invitrogen™ Human LIS1 (aa 16-161) Control Fragment Recombinant Protein

Recombinant Protein

État réglementaire RUO
Séquence ADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHS
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Conjugué Unconjugated
Concentration ≥5.0 mg/mL
Formule 1 M urea, PBS with no preservative; pH 7.4
Nom Human LIS1 (aa 16-161) Control Fragment
Forme Liquid
À utiliser avec (application) Blocking Assay,Control
Recombinant Recombinant
6

Invitrogen™ Human SLC7A5 (aa 16-50) Control Fragment Recombinant Protein

Recombinant Protein

État réglementaire RUO
Séquence AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Conjugué Unconjugated
Concentration ≥5.0 mg/mL
Formule 1 M urea, PBS with no preservative; pH 7.4
Nom Human SLC7A5 (aa 16-50) Control Fragment
Forme Liquid
À utiliser avec (application) Blocking Assay,Control
Recombinant Recombinant
12

MilliporeSigma™ Casein, Bovine Milk, Carbohydrate and Fatty Acid Free, Protein

État réglementaire RUO
Méthode de préparation Dilute Alkaline Solutions (10mg/mL)
Conditions de stockage Following reconstitution, store in the refrigerator (4°C). Stock solutions are stable for up to 1 week at 4°C. After one week, it is recommended that fresh solution be prepared.
Immunogène Casein
Pureté ou qualité ≥95%
Sans additif Carbohydrate and Fatty Acid Free
Espèces Bovine
Méthode de purification Assay
Forme Solid
Recombinant Native
14

Invitrogen™ Human IL-34 (Carrier-Free) Recombinant Protein, eBioscience™

Recombinant Protein

Plage de pH 3.0
Numéro d’adhésion Q6ZMJ4
Réactivité spécifique Human
Type de produit Recombinant Protein, Carrier-Free
Concentration en endotoxines Less than 0.1ng/μg cytokine as determined by the LAL assay
Pureté ou qualité Affinity chromatography
Activité biologique The activity of this protein was determined by measuring MCP-1 secretion from normal human peripheral blood cells.
Sous-type de protéine Recombinant
Réactivité croisée Hu
Conjugué Unconjugated
Forme structurelle HEK 293 cells (amino acids Asn21-Pro242; Accession # NP_001166243); contains a C-terminal 8X His tag
Espèces Human (HEK293)
Nom Human IL-34 Carrier-Free
Forme Lyophilized
Nom usuel Human IL-34 Carrier-Free
État réglementaire RUO
Poids moléculaire 52.5kDa
Conditions de stockage -20°C
Identification génétique (Entrez) 146433
Méthode de purification SDS-PAGE and HPLC
Symbole de gène(s) IL34
Durée de conservation 12 Months
Formule 0.02M citric acid with no preservative; pH 3.0
Recombinant Recombinant
15

Invitrogen™ Human SLC6A7 (aa 560-629) Control Fragment Recombinant Protein

Recombinant Protein

État réglementaire RUO
Séquence REEGSLWERLQQASRPAMDWGPSLEENRTGMYVATLAGSQSPKPLMVHMRKYGGITSFENTAIEVDREIA
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Conjugué Unconjugated
Concentration ≥5.0 mg/mL
Formule 1 M urea, PBS with no preservative; pH 7.4
Nom Human SLC6A7 (aa 560-629) Control Fragment
Forme Liquid
À utiliser avec (application) Blocking Assay,Control
Recombinant Recombinant