Recombinant Proteins
Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
Form
- (1)
- (1)
- (23,210)
- (5,054)
- (29)
- (22)
- (26)
- (35)
For Use With (Application)
- (2)
- (79)
- (3)
- (1)
- (1)
- (14)
- (539)
- (3)
- (21,573)
- (1)
- (1)
- (2)
- (6)
- (44)
- (2)
- (2)
- (2)
- (2)
- (1)
- (2)
- (3)
- (1)
- (1)
- (3)
- (5)
- (10)
- (22,203)
- (1)
- (2)
- (1)
- (1)
- (1,985)
- (51)
- (1)
- (14)
- (8)
- (2)
- (1)
- (8)
- (1)
- (1)
- (1)
- (8)
- (4,234)
- (134)
- (1)
- (1)
- (4)
- (1)
- (20)
- (3)
- (23)
- (27)
- (5)
- (2)
- (13)
- (1)
- (1,227)
- (2)
- (18)
- (26)
- (1)
- (2)
- (1)
- (18)
- (2)
- (4)
- (1)
- (4)
- (1)
- (7)
- (1)
- (1)
- (3)
- (1)
- (1)
- (64)
- (3)
- (6)
- (1)
- (1)
- (6)
- (7)
- (5)
- (1)
- (1)
- (7)
- (6)
- (3)
- (14)
- (2)
- (4)
- (4)
- (6)
- (1)
- (1,974)
- (118)
- (1)
- (1)
Recombinant
- (69)
- (28,242)
Conjugate
- (11)
- (1)
- (4)
- (2)
- (9)
- (7)
- (1)
- (7)
- (1)
- (3)
- (1)
- (1)
- (2)
- (1)
- (4)
- (8)
- (2)
- (1)
- (13)
- (5)
- (1)
- (2)
- (3)
- (27,957)
Species
- (1)
- (9)
- (25)
- (2)
- (1)
- (280)
- (23,131)
- (2)
- (101)
- (1)
- (2)
- (1)
- (1)
- (4)
- (8)
- (3)
- (179)
- (15)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
1
–
15
of
24,494
results
| Regulatory Status | RUO |
|---|---|
| Preparation Method | Dilute alkaline solutions (1mg/mL) |
| Form | Solid |
| Immunogen | Casein |
| Storage Requirements | Following reconstitution, aliquot and freeze (−20°C). Stock solutions are stable for up to 3 months at −20°C. |
| Species | Bovine |
| Recombinant | Native |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | ADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHS |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human LIS1 (aa 16-161) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human SLC7A5 (aa 16-50) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purification Method | Assay |
| Preparation Method | Dilute Alkaline Solutions (10mg/mL) |
| Purity or Quality Grade | ≥95% |
| Form | Solid |
| Without Additives | Carbohydrate and Fatty Acid Free |
| Immunogen | Casein |
| Storage Requirements | Following reconstitution, store in the refrigerator (4°C). Stock solutions are stable for up to 1 week at 4°C. After one week, it is recommended that fresh solution be prepared. |
| Species | Bovine |
| Recombinant | Native |
| Purity or Quality Grade | Affinity chromatography |
|---|---|
| Conjugate | Unconjugated |
| Specific Reactivity | Human |
| Form | Lyophilized |
| pH Range | 3.0 |
| Common Name | Human IL-34 Carrier-Free |
| Molecular Weight (g/mol) | 52.5kDa |
| Gene Symbol | IL34 |
| Endotoxin Concentration | Less than 0.1ng/μg cytokine as determined by the LAL assay |
| Storage Requirements | -20°C |
| Protein Subtype | Recombinant |
| Name | Human IL-34 Carrier-Free |
| Accession Number | Q6ZMJ4 |
| Regulatory Status | RUO |
| Purification Method | SDS-PAGE and HPLC |
| Product Type | Recombinant Protein, Carrier-Free |
| Biological Activity | The activity of this protein was determined by measuring MCP-1 secretion from normal human peripheral blood cells. |
| Gene ID (Entrez) | 146433 |
| Formulation | 0.02M citric acid with no preservative; pH 3.0 |
| Structural Form | HEK 293 cells (amino acids Asn21-Pro242; Accession # NP_001166243); contains a C-terminal 8X His tag |
| Shelf Life | 12 Months |
| Cross Reactivity | Hu |
| Species | Human (HEK293) |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | TSQASGQIFITQTLGIKGYRTVVALDKVPEDVQEYSWYWGANDSAGNMIISHKPPSAQQPGPMYTGRERVNREGSLLIRPTAL |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human CEACAM18 Control Fragment |
| Recombinant | Recombinant |