Recombinant Proteins
Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
Forme
- (1)
- (1)
- (23,208)
- (5,051)
- (29)
- (22)
- (26)
- (35)
À utiliser avec (application)
- (2)
- (79)
- (3)
- (1)
- (1)
- (93)
- (789)
- (3)
Recombinant
- (69)
- (28,237)
Conjugué
- (11)
- (1)
- (4)
- (2)
- (9)
- (7)
- (1)
- (7)
Espèces
- (2)
- (5)
- (29)
- (2)
- (1)
- (269)
- (23,144)
- (2)
Résultats de la recherche filtrée
Les produits de certains de nos fournisseurs ne s'affichent pas dans les résultats de la recherche filtrée. Veuillez
supprimer tous les filtres
pour voir ces produits.
1
–
15
de
24,485
résultats
| État réglementaire | RUO |
|---|---|
| Méthode de préparation | Dilute alkaline solutions (1mg/mL) |
| Conditions de stockage | Following reconstitution, aliquot and freeze (−20°C). Stock solutions are stable for up to 3 months at −20°C. |
| Immunogène | Casein |
| Espèces | Bovine |
| Forme | Solid |
| Recombinant | Native |
| État réglementaire | RUO |
|---|---|
| Séquence | DFKQVLHSWFRQPQSNWGIEINAFDPSGTDLAVTSLGPGAEGLHPFMELRVLENT |
| Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human GDF11 (aa 239-293) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |
| État réglementaire | RUO |
|---|---|
| Séquence | GHHEVDHFLREMPALIRMACVSTVAIE |
| Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human OR2W3 (aa 170-196) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |
| État réglementaire | RUO |
|---|---|
| Séquence | AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI |
| Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human SLC7A5 (aa 16-50) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |
| État réglementaire | RUO |
|---|---|
| Séquence | ADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHS |
| Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugué | Unconjugated |
| Concentration | ≥5.0 mg/mL |
| Formule | 1 M urea, PBS with no preservative; pH 7.4 |
| Nom | Human LIS1 (aa 16-161) Control Fragment |
| Forme | Liquid |
| À utiliser avec (application) | Blocking Assay,Control |
| Recombinant | Recombinant |
| État réglementaire | RUO |
|---|---|
| Méthode de préparation | Dilute Alkaline Solutions (10mg/mL) |
| Conditions de stockage | Following reconstitution, store in the refrigerator (4°C). Stock solutions are stable for up to 1 week at 4°C. After one week, it is recommended that fresh solution be prepared. |
| Immunogène | Casein |
| Pureté ou qualité | ≥95% |
| Sans additif | Carbohydrate and Fatty Acid Free |
| Espèces | Bovine |
| Méthode de purification | Assay |
| Forme | Solid |
| Recombinant | Native |