
Recombinant Proteins
Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
Forme
- (1)
- (1)
- (23,208)
- (5,042)
- (29)
- (22)
- (26)
- (34)
À utiliser avec (application)
- (2)
- (79)
- (3)
- (1)
- (3)
- (1)
- (3)
- (21,579)
Recombinant
- (69)
- (28,225)
Conjugué
- (11)
- (1)
- (4)
- (2)
- (9)
- (7)
- (1)
- (7)
Espèces
- (1)
- (9)
- (25)
- (2)
- (1)
- (274)
- (23,128)
- (2)

1
–
15
de
24,391
résultats
Plage de pH | 3.0 |
---|---|
Numéro d’adhésion | Q6ZMJ4 |
Réactivité spécifique | Human |
Type de produit | Recombinant Protein, Carrier-Free |
Concentration en endotoxines | Less than 0.1ng/μg cytokine as determined by the LAL assay |
Pureté ou qualité | Affinity chromatography |
Activité biologique | The activity of this protein was determined by measuring MCP-1 secretion from normal human peripheral blood cells. |
Sous-type de protéine | Recombinant |
Réactivité croisée | Hu |
Conjugué | Unconjugated |
Forme structurelle | HEK 293 cells (amino acids Asn21-Pro242; Accession # NP_001166243); contains a C-terminal 8X His tag |
Espèces | Human (HEK293) |
Nom | Human IL-34 Carrier-Free |
Forme | Lyophilized |
Nom usuel | Human IL-34 Carrier-Free |
État réglementaire | RUO |
Poids moléculaire | 52.5kDa |
Conditions de stockage | -20°C |
Identification génétique (Entrez) | 146433 |
Méthode de purification | SDS-PAGE and HPLC |
Symbole de gène(s) | IL34 |
Durée de conservation | 12 Months |
Formule | 0.02M citric acid with no preservative; pH 3.0 |
Recombinant | Recombinant |
Invitrogen™ Cholera Toxin Subunit B (Recombinant), Biotin-XX Conjugate
Made from a recombinant version of the B subunit only to provide a very high-purity product that is completely free of the toxic A subunit
Invitrogen™ Isolectin GS-IB4 From Griffonia simplicifolia, biotin-XX Conjugate
Isolated from the seeds of Griffonia simplicifolia, a tropical African legume
État réglementaire | RUO |
---|---|
Séquence | VCAFDNRATGREQEAQVEQLLGMVEGLVLEHKGAHYSNEVYELAQVLRWAGPEERLRRVAERVAARVQ |
Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
Conjugué | Unconjugated |
Concentration | ≥5.0 mg/mL |
Formule | 1 M urea, PBS with no preservative; pH 7.4 |
Nom | Human GIMAP1 (aa 185-252) Control Fragment |
Forme | Liquid |
À utiliser avec (application) | Blocking Assay,Control |
Recombinant | Recombinant |
État réglementaire | RUO |
---|---|
Séquence | KLVGTKALSTTGKALRTLPTAKVFISLPPNLDFKVAPSILKPRKAPALLCLRGPQLEVPCCLCPLKSEQFLAPV |
Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
Conjugué | Unconjugated |
Concentration | ≥5.0 mg/mL |
Formule | 1 M urea, PBS with no preservative; pH 7.4 |
Nom | Human TTLL3 (aa 598-671) Control Fragment |
Forme | Liquid |
À utiliser avec (application) | Blocking Assay,Control |
Recombinant | Recombinant |
État réglementaire | RUO |
---|---|
Séquence | LWIVQRRKTLNFDGRLPACATPAEVRGDALRNLPDSVLFEYFVCRKPKIRERRLQRVTATAGEDVRFLCR |
Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
Conjugué | Unconjugated |
Concentration | ≥5.0 mg/mL |
Formule | 1 M urea, PBS with no preservative; pH 7.4 |
Nom | Human LINGO3 (aa 361-430) Control Fragment |
Forme | Liquid |
À utiliser avec (application) | Blocking Assay,Control |
Recombinant | Recombinant |
État réglementaire | RUO |
---|---|
Séquence | DFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVAC |
Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
Conjugué | Unconjugated |
Concentration | ≥5.0 mg/mL |
Formule | 1 M urea, PBS with no preservative; pH 7.4 |
Nom | Human GPR41 (aa 286-343) Control Fragment |
Forme | Liquid |
À utiliser avec (application) | Blocking Assay,Control |
Recombinant | Recombinant |
État réglementaire | RUO |
---|---|
Séquence | SDPAHYIPPLTFVPVTVPAYWQIHMERVKVG |
Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
Conjugué | Unconjugated |
Concentration | ≥5.0 mg/mL |
Formule | 1 M urea, PBS with no preservative; pH 7.4 |
Nom | Human NAPSA (aa 238-268) Control Fragment |
Forme | Liquid |
À utiliser avec (application) | Blocking Assay,Control |
Recombinant | Recombinant |
État réglementaire | RUO |
---|---|
Séquence | GDFARFDPQGGLAGIAAIKAHLDILVERSNRSRAINVPPRVTVLPKSRVE |
Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
Conjugué | Unconjugated |
Concentration | ≥5.0 mg/mL |
Formule | 1 M urea, PBS with no preservative; pH 7.4 |
Nom | Human HLA-DOA (aa 75-124) Control Fragment |
Forme | Liquid |
À utiliser avec (application) | Blocking Assay,Control |
Recombinant | Recombinant |
État réglementaire | RUO |
---|---|
Séquence | PKQPFMLQHASGEHKDGHGK |
Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
Conjugué | Unconjugated |
Concentration | ≥5.0 mg/mL |
Formule | 1 M urea, PBS with no preservative; pH 7.4 |
Nom | Human TAF1L (aa 1807-1826) Control Fragment |
Forme | Liquid |
À utiliser avec (application) | Blocking Assay,Control |
Recombinant | Recombinant |
État réglementaire | RUO |
---|---|
Séquence | SALPTNDNSYRGILNPSQPGQSSSSSQTFGVSSSGQSVSSNQRPCSSDIPDSPCSGGPIVSHSGPYIPSSHSVSGGQRPVVVVVDQHGSGAPG |
Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
Conjugué | Unconjugated |
Concentration | ≥5.0 mg/mL |
Formule | 1 M urea, PBS with no preservative; pH 7.4 |
Nom | Human CDSN Control Fragment |
Forme | Liquid |
À utiliser avec (application) | Blocking Assay,Control |
Recombinant | Recombinant |
État réglementaire | RUO |
---|---|
Séquence | PQSERIDCTPDQEVTEDICRWQYKCCWSPVADANVPRCFFPWNWGYEASNGHTNTSTGFTAQLKRLPSPSLFGND |
Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
Conjugué | Unconjugated |
Concentration | ≥5.0 mg/mL |
Formule | 1 M urea, PBS with no preservative; pH 7.4 |
Nom | Human MGAM2 (aa 47-121) Control Fragment |
Forme | Liquid |
À utiliser avec (application) | Blocking Assay,Control |
Recombinant | Recombinant |
État réglementaire | RUO |
---|---|
Séquence | IDWKAYMAEVEGVINGTYDYTQLQGDTGPLVYPAGFVYIFMGLYYATSRGTDIR |
Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
Conjugué | Unconjugated |
Concentration | ≥5.0 mg/mL |
Formule | 1 M urea, PBS with no preservative; pH 7.4 |
Nom | Human ALG3 (aa 69-122) Control Fragment |
Forme | Liquid |
À utiliser avec (application) | Blocking Assay,Control |
Recombinant | Recombinant |
État réglementaire | RUO |
---|---|
Séquence | KKRENLGVALEIDGLEEKLSQCRRDLEAVNSRLHSRELS |
Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
Conjugué | Unconjugated |
Concentration | ≥5.0 mg/mL |
Formule | 1 M urea, PBS with no preservative; pH 7.4 |
Nom | Human C6orf129 (aa 4-42) Control Fragment |
Forme | Liquid |
À utiliser avec (application) | Blocking Assay,Control |
Recombinant | Recombinant |
État réglementaire | RUO |
---|---|
Séquence | MRRDVNGVTKSRFEMFSNSDEAVINK |
Pureté ou qualité | >80% by SDS-PAGE and Coomassie blue staining |
Conjugué | Unconjugated |
Concentration | ≥5.0 mg/mL |
Formule | 1 M urea, PBS with no preservative; pH 7.4 |
Nom | Human FBXL20 (aa 1-26) Control Fragment |
Forme | Liquid |
À utiliser avec (application) | Blocking Assay,Control |
Recombinant | Recombinant |