Recombinant Proteins
Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
Form
- (1)
- (1)
- (23,200)
- (5,038)
- (29)
- (22)
- (26)
- (35)
For Use With (Application)
- (2)
- (79)
- (3)
- (1)
- (1)
- (93)
- (785)
- (3)
Recombinant
- (69)
- (28,215)
Conjugate
- (11)
- (1)
- (4)
- (2)
- (9)
- (7)
- (1)
- (7)
Species
- (2)
- (4)
- (29)
- (2)
- (1)
- (256)
- (23,138)
- (1)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
Keyword Search:
Clear search
1
–
15
of
24,466
results
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | PIKPRGPIDIDGFAVLGKLADNPQVSVPFELQWMLIHCDPLRPRRETCHELPARITPSQTTDERGPPGEQGPP |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human COL9A1 (aa 205-277) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | AFLCGGSGDQAEWNLGQDDSALHGKHLPPSPRKRVSSSGLTDSLFILKEENSNKHLGADNVSDPTSGLDFQLTSPEVSQTD |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human DENND1B (aa 617-697) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | FPRFLKSEIYKKLVNSQQVPNHK |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human RGS21 (aa 124-146) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | MDKLKKVLSGQDTEDRSGLSEVVEASSLSWSTR |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human SFT2D2 (aa 1-33) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | VDESLFGDIKSPAQGQSDSPIVLLRDKHTLQKTLTALGLDRKPETIQLITRDMVRELIVPTEDPSGESLIISPEEFERIKWAS |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human CCDC19 (aa 34-116) Control Fragment |
| Recombinant | Recombinant |
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | TOR1AIP2 |
| Gene Symbol | TOR1AIP2 |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | SDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPECYPDNPANRSLV |
| Concentration | ≥5.0 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human TOR1AIP2 (aa 3-63) Control Fragment |
| Accession Number | Q8NFQ8 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | 1110020D10Rik; 15 kDa interferon-responsive protein; 15kDa; A130072J07; AA103493; AW060462; AW610675; C77739; Ifrg15; interferon alpha responsive gene, 15 kDa; interferon alpha responsive protein (15 kDa); interferon alpha responsive protein; torsin-1A-interacting protein 2; interferon responsive gene 15; Lull1; lumenal domain like LAP1; lumenal domain-like LAP1; NET9; RP11-12M5.5; TOR1AIP2; torsin 1A interacting protein 2; torsin A interacting protein 2; torsin-1A-interacting protein 2; Torsin-1A-interacting protein 2, isoform IFRG15 |
| Product Type | Protein |
| Gene ID (Entrez) | 163590 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | LEMRAKADKLKRIEQRDVRKANLKEKKERNQNEALLQAIKARNIRLSEAACEDEDSASEGLGELFLDGLSTENPHGARLSLDGQGRLSWPVLFLYP |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human TTC4 (aa 188-283) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | AQSDFISAFHEDSRFIDHLMVMFGETPSWDLEQKYCPDNLEVYFEDEDRAELYRVPAKSTLLQVLQHQRYFVKALTPAFLVCVGSSPFCKNFLRGRKVYQI |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human TTC4 (aa 286-386) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | EGSALEKSLAVSQGGELYEEWLELRNGCLCCSVK |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human CBWD1 (aa 80-113) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | QLPWSYQEKTHFGHLGQDLIKELVSCCRRKPFALVCGSAEFTKDIARCLLCAGLTEDSYFLF |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human CYB5RL (aa 254-315) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | PFSIEHILSSLPERSLPARAACPPQPAGRQSPAKPEEP |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human GSC2 (aa 19-56) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | QRSSEFCGLGAEFSQNLNFVPSQRVSQIEHFYKPDTHAQSWRCDSAIMYADKVTCENNDYDKTVYQSIQPIYPARIQTGDNLFKCTDAVKSFNHI |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human ZNF606 (aa 207-301) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | ILNIKWLEGVFYAALNICTARNMAHSQVLQLLSELFLSVHFEDCGKDTASCPKLQLTDFVSKAYGKNLSQERPFPWFDLTAVQLKETPFSQHLSSSPVLQDHL |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human NOXRED1 (aa 231-333) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | PMGLSFLPTYGCQSNRTASVATLRMKAREHSEAVLQSANLLPSTSSSPGPVAKPAPPDGSQEKTSPTKEQSEAEKSV |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human DRGX (aa 187-263) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | KMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAWASKDTEAMKRALASIDSKLNQAKGWLRDPSASPGDAGEQAIRQILDEAGKVGELCAGKERREI |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human Vinculin (aa 173-321) Control Fragment |
| Recombinant | Recombinant |