missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP94032

Invitrogen™ Human HSPB11 (aa 4-71) Control Fragment Recombinant Protein

Catalog No. RP94032
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94032 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94032 Supplier Invitrogen™ Supplier No. RP94032
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56362 (PA5-56362. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HSPB11 (Heat shock protein beta-11), also known as IFT25, was originally identified as a small heat shock protein. Recently it has been identified as a component of IFT complex B. It has been demonstrated that IFT25 is not required for ciliary assembly but is required for proper Hedgehog signaling, which in mammals occurs within cilia. Cilia lacking IFT25 have defects in the signal-dependent transport of multiple Hedgehog components and fail to activate the pathway upon stimulation.

Specifications

Accession Number Q9Y547
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51668
Name Human HSPB11 (aa 4-71) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2900042B11Rik; C1orf41; Heat shock protein; Heat shock protein beta-11; heat shock protein family B (small) member 11; heat shock protein family B (small), member 11; HSP; Hspb11; Hspb11 heat shock protein family B (small), member 11; HSPC034; HSPCO34; IFT25; intraflagellar transport 25 homolog; intraflagellar transport protein 25 homolog; Placental protein 25; placental protein 25 homolog; PP25
Common Name HSPB11
Gene Symbol Hspb11
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less