missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TMPRSS9 (aa 105-175) Control Fragment Recombinant Protein

Catalog No. RP101517
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101517 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101517 Supplier Invitrogen™ Supplier No. RP101517
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62415 (PA5-62415. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a membrane-bound type II serine polyprotease that is cleaved to release three different proteases. Two of the proteases are active and can be inhibited by serine protease inhibitors, and one is thought to be catalytically inactive. This gene enhances the invasive capability of pancreatic cancer cells and may be involved in cancer progression.

Specifications

Accession Number Q7Z410
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 360200
Name Human TMPRSS9 (aa 105-175) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias polyserase 1; polyserase-1; Polyserase-I; polyserine protease 1; polyserine protease-1; Serase-1; serase-1 b; Serase-2; Serase-3; TMPRSS9; Transmembrane protease serine 9; transmembrane protease, serine 9; transmembrane serine protease 9
Common Name TMPRSS9
Gene Symbol TMPRSS9
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LEEELLQRGIRARLREHGISLAAYGTIVSAELTGRHKGPLAERDFKSGRCPGNSFSCGNSQCVTKVNPECD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less