missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP98457

Invitrogen™ Human Bcl-B (aa 1-33) Control Fragment Recombinant Protein

Catalog No. RP98457
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98457 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98457 Supplier Invitrogen™ Supplier No. RP98457
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (42%), Rat (42%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111149 (PA5-111149. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The protein encoded by this gene contains conserved BH4, BH1 and BH2 domains. This protein can interact with other members of BCL-2 protein family including BCL2, BCL2L1/BCL-X(L), and BAX. Overexpression of this gene has been shown to suppress cell apoptosis possibly through the prevention of cytochrome C release from the mitochondria, and thus activating caspase-3 activation. The mouse counterpart of this protein is found to interact with Apaf1 and forms a protein complex with Caspase 9, which suggests the involvement of this protein in APAF1 and CASPASE 9 related apoptotic pathway.

Specifications

Accession Number Q9HD36
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10017
Name Human Bcl-B (aa 1-33) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA420380; anti-apoptotic protein Boo; Anti-apoptotic protein NrH; apoptosis regulator Bcl-B; AU023065; Bcl-2 homolog Diva; BCL2 like 10; BCL2L10; bcl2-L-10; Bcl2-like 10; BCL2-like 10 (apoptosis facilitator); bcl-2-like protein 10; BCLB; BCL-B; Boo; C85687; death inducer binding to vBcl-2 and Apaf-1; Diva
Common Name Bcl-B
Gene Symbol BCL2L10
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MVDQLRERTTMADPLRERTELLLADYLGYCARE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less