missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP96154

Invitrogen™ Human FAM126B (aa 287-370) Control Fragment Recombinant Protein

Catalog No. RP96154
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96154 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96154 Supplier Invitrogen™ Supplier No. RP96154
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57551 (PA5-57551. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Component of a complex required to localize phosphatidylinositol 4-kinase (PI4K) to the plasma membrane.

Specifications

Accession Number Q8IXS8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 285172
Name Human FAM126B (aa 287-370) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C130065N10Rik; D1Ertd53e; D630010C10; Fam126b; family with sequence similarity 126 member B; family with sequence similarity 126, member B; HYCC2; Protein FAM126B
Common Name FAM126B
Gene Symbol FAM126B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PFDAPDSTQEGQKVLKVEVTPTVPRISRTAITTASIRRHRWRREGAEGVNGGEESVNLNDADEGFSSGASLSSQPIGTKPSSSS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less