missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP93254

Invitrogen™ Human Rab11fip4 (aa 91-177) Control Fragment Recombinant Protein

Catalog No. RP93254
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP93254 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP93254 Supplier Invitrogen™ Supplier No. RP93254
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54465 (PA5-54465. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Proteins of the large Rab GTPase family have regulatory roles in the formation, targeting, and fusion of intracellular transport vesicles. RAB11FIP4 is one of many proteins that interact with and regulate Rab GTPases.

Specifications

Accession Number Q86YS3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 84440
Name Human Rab11fip4 (aa 91-177) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A730072L08Rik; ARFO2; Arfophilin-2; FIP4-Rab11; Kiaa1821; mKIAA1821; mRab11-FIP4A; RAB11 family interacting protein 4; RAB11 family interacting protein 4 (class II); rab11 family-interacting protein 4; Rab11fip4; RAB11-FIP4
Common Name RAB11FIP4
Gene Symbol RAB11FIP4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VLSVESAGTLPCAPEIPDCVEQGSEVTGPTFADGELIPREPGFFPEDEEEAMTLAPPEGPQELYTDSPMESTQSLEGSVGSPAEKDG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less