Recombinant Proteins
Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
Form
- (1)
- (1)
- (23,208)
- (5,051)
- (29)
- (22)
- (26)
- (35)
For Use With (Application)
- (2)
- (79)
- (3)
- (1)
- (1)
- (93)
- (789)
- (3)
- (21,468)
- (1)
- (1)
- (2)
- (6)
- (44)
- (2)
- (2)
- (2)
- (2)
- (1)
- (2)
- (3)
- (1)
- (1)
- (3)
- (5)
- (10)
- (22,403)
- (1)
- (2)
- (1)
- (1)
- (1,810)
- (181)
- (1)
- (14)
- (8)
- (2)
- (1)
- (8)
- (1)
- (1)
- (1)
- (7)
- (3,998)
- (134)
- (1)
- (1)
- (4)
- (1)
- (20)
- (3)
- (21)
- (27)
- (5)
- (2)
- (13)
- (1)
- (1,227)
- (2)
- (18)
- (26)
- (1)
- (2)
- (1)
- (18)
- (2)
- (180)
- (1)
- (4)
- (1)
- (7)
- (1)
- (1)
- (3)
- (1)
- (1)
- (64)
- (3)
- (6)
- (1)
- (1)
- (6)
- (7)
- (5)
- (1)
- (1)
- (7)
- (6)
- (3)
- (14)
- (2)
- (4)
- (4)
- (6)
- (1)
- (1,892)
- (205)
- (1)
- (1)
Recombinant
- (69)
- (28,237)
Conjugate
- (11)
- (1)
- (4)
- (2)
- (9)
- (7)
- (1)
- (7)
- (1)
- (3)
- (1)
- (1)
- (2)
- (1)
- (4)
- (8)
- (2)
- (1)
- (13)
- (5)
- (1)
- (2)
- (3)
- (27,953)
Species
- (2)
- (5)
- (29)
- (2)
- (1)
- (269)
- (23,144)
- (2)
- (1)
- (1)
- (116)
- (1)
- (6)
- (1)
- (1)
- (8)
- (12)
- (179)
- (15)
Showing products from the Recombinant Proteins category.
View All Search Results
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
Keyword Search:
Clear search
1
–
15
of
24,485
results
| Regulatory Status | RUO |
|---|---|
| Preparation Method | Dilute alkaline solutions (1mg/mL) |
| Form | Solid |
| Immunogen | Casein |
| Storage Requirements | Following reconstitution, aliquot and freeze (−20°C). Stock solutions are stable for up to 3 months at −20°C. |
| Species | Bovine |
| Recombinant | Native |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | DFKQVLHSWFRQPQSNWGIEINAFDPSGTDLAVTSLGPGAEGLHPFMELRVLENT |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human GDF11 (aa 239-293) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | GHHEVDHFLREMPALIRMACVSTVAIE |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human OR2W3 (aa 170-196) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | ADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHS |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human LIS1 (aa 16-161) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human SLC7A5 (aa 16-50) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purification Method | Assay |
| Preparation Method | Dilute Alkaline Solutions (10mg/mL) |
| Purity or Quality Grade | ≥95% |
| Form | Solid |
| Without Additives | Carbohydrate and Fatty Acid Free |
| Immunogen | Casein |
| Storage Requirements | Following reconstitution, store in the refrigerator (4°C). Stock solutions are stable for up to 1 week at 4°C. After one week, it is recommended that fresh solution be prepared. |
| Species | Bovine |
| Recombinant | Native |