Recombinant Proteins
Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
Conjugate
- (11)
- (1)
- (4)
- (2)
- (9)
- (8)
- (1)
- (18)
- (1)
- (3)
- (1)
- (1)
- (3)
- (2)
- (1)
- (9)
- (2)
- (1)
- (13)
- (5)
- (1)
- (2)
- (3)
- (34,002)
For Use With (Application)
- (2)
- (926)
- (79)
- (3)
- (1)
- (1)
- (1)
- (123)
- (1,026)
- (3)
- (2)
- (7)
- (21,447)
- (2)
- (1)
- (1)
- (2)
- (6)
- (44)
- (2)
- (2)
- (2)
- (2)
- (1)
- (2)
- (3)
- (1)
- (1)
- (3)
- (1)
- (5)
- (10)
- (22,401)
- (1)
- (2)
- (1)
- (9)
- (1)
- (2,393)
- (175)
- (8)
- (1)
- (31)
- (8)
- (2)
- (1)
- (8)
- (1)
- (1)
- (1)
- (22)
- (4,030)
- (160)
- (1)
- (1)
- (1)
- (4)
- (1)
- (29)
- (25)
- (3)
- (15)
- (42)
- (7)
- (35)
- (41)
- (32)
- (1)
- (13)
- (1)
- (1,226)
- (1)
- (18)
- (26)
- (1)
- (2)
- (1)
- (1)
- (18)
- (2)
- (191)
- (1)
- (4)
- (1)
- (26)
- (2)
- (6)
- (1)
- (1)
- (3)
- (1)
- (1)
- (1)
- (91)
- (3)
- (6)
- (1)
- (1)
- (6)
- (7)
- (5)
- (1)
- (1)
- (3,735)
- (6)
- (3)
- (14)
- (2)
- (4)
- (4)
- (2)
- (5)
- (1)
- (2,099)
- (205)
- (1)
- (1)
Recombinant
- (69)
- (33,170)
Form
- (1)
- (23,202)
- (5,076)
- (29)
- (146)
- (26)
- (35)
Species
- (2)
- (72)
- (4)
- (30)
- (2)
- (1)
- (2)
- (2)
- (353)
- (1)
- (1)
- (1)
- (25,999)
- (1)
- (1)
- (4)
- (1)
- (558)
- (1)
- (7)
- (6)
- (1)
- (2)
- (1)
- (11)
- (95)
- (4)
- (2)
- (8)
- (3)
- (2)
- (179)
- (15)
Showing products from the Recombinant Proteins category.
View All Search Results
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
Search Within Results
Keyword Search:
Clear All
1
–
15
of
30,647
results
1
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | Importin 7 |
| Gene Symbol | Ipo7 |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | RAYACHAEHENDSDDDDEAEDDDETEELGSDEDDIDEDGQEYLEILAKQAGEDGDDEDWEEDDAEETALEGYSTIIDDEDNPVDEY |
| Concentration | 0.5 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human Importin 7 (aa 874-959) Control Fragment |
| Accession Number | O95373 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | A330055O14Rik; C330016G14; FLJ14581; Imp7; importin 7; importin-7; IPO7; MGC138673; RAN binding protein 7; RAN-binding protein 7; RanBP7 |
| Product Type | Protein |
| Gene ID (Entrez) | 10527 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
2
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | CD22 |
| Gene Symbol | CD22 |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | SVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKE |
| Concentration | 2.6 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human CD22 (aa 450-538) Control Fragment |
| Accession Number | P20273 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | A530093D23; B-cell receptor CD22; BL-CAM; B-lymphocyte cell adhesion molecule; B-lymphocyte cell adhesion molecule (BL-CAM); Cd22; CD22 antigen; CD22 molecule; FLJ22814; Lectin 2; Leu-14; Lyb8; Lyb-8; MGC130020; sialic acid binding Ig-like lectin 2; sialic acid-binding Ig-like lectin 2; Sialic acid-binding Ig-like lectin 2 (Siglec-2); Siglec2; Siglec-2; T-cell surface antigen Leu-14 |
| Product Type | Protein |
| Gene ID (Entrez) | 933 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
3
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | PLEKHG7 |
| Gene Symbol | PLEKHG7 |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | IKEGGSCTVLDQPIPLDRLVVKSIEPLHVSVFGLRNAFLIQHENRYRQCIAAFLLQAQTENIKKTWMAQITTAISCFTKSQETKKI |
| Concentration | ≥5.0 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human PLEKHG7 (aa 594-679) Control Fragment |
| Accession Number | Q6ZR37 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | PH domain-containing family G member 7; pleckstrin homology and RhoGEF domain containing G7; pleckstrin homology domain containing, family G (with RhoGef domain) member 7; pleckstrin homology domain-containing family G member 7; PLEKHG7 |
| Product Type | Protein |
| Gene ID (Entrez) | 440107 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
4
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | AP000322.53 |
| Gene Symbol | SMIM34 |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | NILRKNDKSLEDVYYSNLTSELKMTGLQGKVAKCSTLSISNRAVLQPCQAHLGAKGGSS |
| Concentration | ≥5.0 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human AP000322.53 Control Fragment |
| Accession Number | A8MWV9 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Product Type | Protein |
| Gene ID (Entrez) | 388820 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
5
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | CT83 |
| Gene Symbol | CT83 |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | QRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST |
| Concentration | 4.2 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human CT83 (aa 25-113) Control Fragment |
| Accession Number | Q5H943 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | Cancer/testis antigen 83; CT83; CXorf61; kita-kyushu lung cancer antigen 1; KKLC1; KK-LC-1 |
| Product Type | Protein |
| Gene ID (Entrez) | 203413 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
6
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | FAM55D |
| Gene Symbol | NXPE4 |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | LSKQEKSLFERSNVGVEIMEKFNTISVSKCNKETVAMKEKCKFGMTSTIPSGHVWRNTWNPVSCSLATVKMKE |
| Concentration | 1 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human FAM55D (aa 267-339) Control Fragment |
| Accession Number | Q6UWF7 |
| Regulatory Status | RUO |
| Purification Method | Metal-chelate chromatography |
| Gene Alias | C11orf33; C130036J11; D930028F11Rik; Fam55b; Fam55d; family with sequence similarity 55, member B; family with sequence similarity 55, member D; hypothetical protein LOC244853; hypothetical protein LOC515648; LOC100731209; neurexophilin and PC-esterase domain family member 4; neurexophilin and PC-esterase domain family, member 4; NXPE family member 4; Nxpe4; Protein FAM55D; UNQ3018/PRO9799 |
| Product Type | Protein |
| Gene ID (Entrez) | 54827 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
7
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | RPL13A |
| Gene Symbol | RPL13A |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | AHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNV |
| Concentration | 5.60 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human RPL13A (aa 142-185) Control Fragment |
| Accession Number | P40429 |
| Regulatory Status | RUO |
| Purification Method | Metal-chelate chromatography |
| Gene Alias | 1810026N22Rik; 23 kDa highly basic protein; 60S ribosomal protein L13a; L13A; Large ribosomal subunit protein uL13; P198; ribosomal protein L13a; Rpl13a; tissue specific transplantation antigen 1; tissue specific transplantation antigen P198-7; transplantation antigen P198; TSTA1; Tstap198-7; tum-antigen; Tum-P198 antigen; tum-transplantation antigen P198 |
| Product Type | Protein |
| Gene ID (Entrez) | 23521 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
8
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | P-Selectin (CD62P) |
| Gene Symbol | SELP |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | EAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFMLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNEGLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMT |
| Concentration | 1.7 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human P-Selectin (aa 382-522) Control Fragment |
| Accession Number | P16109 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | CD62; CD62 antigen-like family member P; CD62P; CD62P antigen; CD62P; CD62 homolog; FLJ45155; GMP140; GMP-140; GMRP; Granule membrane protein 140; granule membrane protein 140kDa; granulocyte membrane protein; Grmp; LECAM3; leukocyte-endothelial cell adhesion molecule 3; PADGEM; Platelet activation dependent granule-external membrane protein; platelet alpha-granule membrane protein; PSEL; PSELECT; P-selectin; P-selectin precursor; RP1-86F14.2; selectin P; selectin P (granule membrane protein 140kDa, antigen CD62); selectin, platelet; Selp |
| Product Type | Protein |
| Gene ID (Entrez) | 6403 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
9
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | ERV3 |
| Gene Symbol | ERV3-1 |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | QLAENIASSLHVASCYVCGGMNMGDQWPWEARELMPQDNFTLTASSLEPAPSSQSIWFLKTSIIGKFCIARWGKAFTDPVGELTCLGQQYYNETLGKTLWRGKSNNSESPHPSPFSRFPSLNHSWYQLEA |
| Concentration | 4 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human ERV3 (aa 278-407) Control Fragment |
| Accession Number | Q14264 |
| Regulatory Status | RUO |
| Purification Method | Metal-chelate chromatography |
| Gene Alias | endogenous retroviral sequence 3; endogenous retrovirus group 3 member 1; endogenous retrovirus group 3 member 1 Env polyprotein; endogenous retrovirus group 3, member 1; Envelope polyprotein; envR; ERV3; ERV3 envelope protein; ERV-3 envelope protein; ERV3-1; ERV3-1 envelope protein; ERVR; ERV-R; ERV-R envelope protein; HERVR; HERV-R; HERV-R envelope protein; HERV-R_7q21.2 provirus ancestral Env polyprotein; SU; Surface protein; TM; Transmembrane protein |
| Product Type | Protein |
| Gene ID (Entrez) | 2086 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
10
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | TREH |
| Gene Symbol | TREH |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | LYQDDKQFVDMPLSIAPEQVLQTFTELSRDHNHSIPREQLQAFVHEHFQAKGQELQPWTPADWKDSPQFLQKISDAKLRAWAGQLHQLWKKLGKK |
| Concentration | 2.60 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human TREH (aa 47-141) Control Fragment |
| Accession Number | O43280 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | 2210412M19Rik; Alpha,alpha-trehalase; alpha,alpha-trehalose glucohydrolase; LOW QUALITY PROTEIN: trehalase; trehalase; si:ch211-147p17.2; TRE; TREA; TREH; Trehalase; trehalase (brush-border membrane glycoprotein) |
| Product Type | Protein |
| Gene ID (Entrez) | 11181 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
11
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | SHIP2 |
| Gene Symbol | INPPL1 |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | TLGELIGLYAQPNQGLVCALLLPVEGEREPDPPDDRDASDGEDEKPPLPPRSGSTSISAPTGPSSPLPAPETPTAPAAESAPNGLST |
| Concentration | ≥5.0 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human SHIP2 (aa 94-180) Control Fragment |
| Accession Number | O15357 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | 51C; 51C protein; ablSH3-binding protein; inositol polyphosphate phosphatase like 1; inositol polyphosphate phosphatase-like 1; inositol polyphosphate phosphatase-like protein 1; Inppl1; INPPL-1; NS1; OPSMD; Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2; phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2; protein 51C; PTP2C; SH2 domain-containing inositol 5'-phosphatase 2; SH2 domain-containing inositol phosphatase 2; SH2 domain-containing inositol-5'-phosphatase 2; SH2-containing inositol phosphatase 2; SHIP2; SHIP-2; SHP-2; SH-PTP2 |
| Product Type | Protein |
| Gene ID (Entrez) | 3636 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
12
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | NF-M |
| Gene Symbol | NEFM |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | KEEEEKEVKEAPKEEKVEKKEEKPKDVPEKKKAESPVKEEAVAEVVTITKSVKVHLEKETKEEGKPLQQEKEKEKAGGEGGSEEEGSDKGAKG |
| Concentration | 3.90 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human NEFM (aa 702-794) Control Fragment |
| Accession Number | P07197 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | 160 kDa neurofilament protein; major neuronal intermediate filament subunit; medium neurofilament subunit; middle molecular weight neurofilament protein NF-M(2); Nef3; Nefm; nef-m; nefm.S; nefm-a; nefm-b; Neurofilament 3; neurofilament 3 (150kDa medium); neurofilament 3, medium; neurofilament M subunit; neurofilament medium; neurofilament medium polypeptide; neurofilament medium S homeolog; neurofilament medium tail domain; neurofilament protein M; Neurofilament protein, middle polypeptide; neurofilament triplet M protein; neurofilament, medium polypeptide; neurofilament, medium polypeptide 150kDa; neurofilament, medium polypeptide S homeolog; neurofilament-3 (150 kD medium); neurofilament-M; neurofilament-M subunit; neuronal intermediate filament; NF160; NF165; NFM; NF-M; NF-M c-terminus; NF-M protein; NMC; XELAEV_18020229mg |
| Product Type | Protein |
| Gene ID (Entrez) | 4741 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
13
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | PDK1 |
| Gene Symbol | PDK1 |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | KEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHND |
| Concentration | ≥5.0 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human PDK1 (aa 92-151) Control Fragment |
| Accession Number | Q15118 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial; [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1, mitochondrial; B830012B01; D530020C15Rik; isoenzyme 1; kinase isoenzyme 1; lipoamide; mitochondrial pyruvate dehydrogenase, lipoamide, kinase isoenzyme 1; PDH kinase 1; PDHK1; PDK p48; Pdk1; pyruvate dehydrogenase; pyruvate dehydrogenase kinase 1; Pyruvate dehydrogenase kinase isoform 1; pyruvate dehydrogenase kinase, isoenzyme 1; pyruvate dehydrogenase kinase, isozyme 1 |
| Product Type | Protein |
| Gene ID (Entrez) | 5163 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
14
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | NAPSA |
| Gene Symbol | NAPSA |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | DGILGLGFPILSVEGVRPPLDVLVEQGLLDKPVFSF |
| Concentration | 2.5 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human NAPSA Control Fragment |
| Accession Number | O96009 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | asp 4; ASP4; Aspartyl protease 4; KAP; Kdap; KDAP-1; kidney-derived aspartic protease-like protein; Nap; NAP1; NAPA; Napsa; napsin A aspartic peptidase; napsin-1; Napsin-A; pronapsin; pronapsin A; SNAPA; TA01/TA02 |
| Product Type | Protein |
| Gene ID (Entrez) | 9476 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
15
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | TOE1 |
| Gene Symbol | TOE1 |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | LHRAGFDAFMTGYVMAYVEVSQGPQPCSSGPWLPECHNKVYLSGKAVPLTVAKSQFSRSSKAHNQKMKLTWGS |
| Concentration | 4.1 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human TOE1 (aa 437-509) Control Fragment |
| Accession Number | Q96GM8 |
| Regulatory Status | RUO |
| Purification Method | Metal-chelate chromatography |
| Gene Alias | 4930584N22Rik; 4933424D16Rik; AI413517; hCaf1z; Target of EGR1 protein 1; target of EGR1, member 1 (nuclear); TOE1 |
| Product Type | Protein |
| Gene ID (Entrez) | 114034 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |