missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human FAM55D (aa 267-339) Control Fragment Recombinant Protein

Catalog No. RP97345
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP97345 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP97345 Supplier Invitrogen™ Supplier No. RP97345
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60128. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The function remains unknown.

Specifications

Accession Number Q6UWF7
Concentration 1 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 54827
Name Human FAM55D (aa 267-339) Control Fragment
pH Range 7.4
Purification Method Metal-chelate chromatography
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias C11orf33; C130036J11; D930028F11Rik; Fam55b; Fam55d; family with sequence similarity 55, member B; family with sequence similarity 55, member D; hypothetical protein LOC244853; hypothetical protein LOC515648; LOC100731209; neurexophilin and PC-esterase domain family member 4; neurexophilin and PC-esterase domain family, member 4; NXPE family member 4; Nxpe4; Protein FAM55D; UNQ3018/PRO9799
Common Name FAM55D
Gene Symbol NXPE4
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LSKQEKSLFERSNVGVEIMEKFNTISVSKCNKETVAMKEKCKFGMTSTIPSGHVWRNTWNPVSCSLATVKMKE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less