missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP96522

Invitrogen™ Human SHIP2 (aa 94-180) Control Fragment Recombinant Protein

Catalog No. RP96522
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96522 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96522 Supplier Invitrogen™ Supplier No. RP96522
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83381. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is an SH2-containing 5'-inositol phosphatase that is involved in the regulation of insulin function. The encoded protein also plays a role in the regulation of epidermal growth factor receptor turnover and actin remodeling. Additionally, this gene supports metastatic growth in breast cancer and is a valuable biomarker for breast cancer.

Specifications

Accession Number O15357
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 3636
Name Human SHIP2 (aa 94-180) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 51C; 51C protein; ablSH3-binding protein; inositol polyphosphate phosphatase like 1; inositol polyphosphate phosphatase-like 1; inositol polyphosphate phosphatase-like protein 1; Inppl1; INPPL-1; NS1; OPSMD; Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2; phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2; protein 51C; PTP2C; SH2 domain-containing inositol 5'-phosphatase 2; SH2 domain-containing inositol phosphatase 2; SH2 domain-containing inositol-5'-phosphatase 2; SH2-containing inositol phosphatase 2; SHIP2; SHIP-2; SHP-2; SH-PTP2
Common Name SHIP2
Gene Symbol INPPL1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TLGELIGLYAQPNQGLVCALLLPVEGEREPDPPDDRDASDGEDEKPPLPPRSGSTSISAPTGPSSPLPAPETPTAPAAESAPNGLST
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less