missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP104560

Invitrogen™ Human ERV3 (aa 278-407) Control Fragment Recombinant Protein

Catalog No. RP104560
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP104560 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP104560 Supplier Invitrogen™ Supplier No. RP104560
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (19%), Rat (19%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82579. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution. This endogenous envelope protein has lost its fusogenic properties. It can inhibit cell growth through decrease expression of cyclin B1 and increased expression of p21 in vitro.

Specifications

Accession Number Q14264
Concentration 4 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 2086
Name Human ERV3 (aa 278-407) Control Fragment
pH Range 7.4
Purification Method Metal-chelate chromatography
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias endogenous retroviral sequence 3; endogenous retrovirus group 3 member 1; endogenous retrovirus group 3 member 1 Env polyprotein; endogenous retrovirus group 3, member 1; Envelope polyprotein; envR; ERV3; ERV3 envelope protein; ERV-3 envelope protein; ERV3-1; ERV3-1 envelope protein; ERVR; ERV-R; ERV-R envelope protein; HERVR; HERV-R; HERV-R envelope protein; HERV-R_7q21.2 provirus ancestral Env polyprotein; SU; Surface protein; TM; Transmembrane protein
Common Name ERV3
Gene Symbol ERV3-1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QLAENIASSLHVASCYVCGGMNMGDQWPWEARELMPQDNFTLTASSLEPAPSSQSIWFLKTSIIGKFCIARWGKAFTDPVGELTCLGQQYYNETLGKTLWRGKSNNSESPHPSPFSRFPSLNHSWYQLEA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less