missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP97882

Invitrogen™ Human PLEKHG7 (aa 594-679) Control Fragment Recombinant Protein

Catalog No. RP97882
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP97882 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP97882 Supplier Invitrogen™ Supplier No. RP97882
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (23%), Rat (23%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-144820, PA5-63884. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The PLEKHG7 gene (Pleckstrin Homology and RhoGEF Domain Containing G7) encodes a protein that is a member of the Rho guanine nucleotide exchange factor (RhoGEF) family. This protein is involved in the regulation of the Rho family of GTPases, which play a critical role in multiple cellular processes including cytoskeletal organization, cell migration, and cell proliferation. The pleckstrin homology (PH) domain of PLEKHG7 allows it to interact with phosphoinositides, which helps localize the protein to cellular membranes where it can activate Rho GTPases. Dysregulation of PLEKHG7 has been implicated in certain cancers, highlighting its importance in cell signaling and cancer biology.

Specifications

Accession Number Q6ZR37
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 440107
Name Human PLEKHG7 (aa 594-679) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias PH domain-containing family G member 7; pleckstrin homology and RhoGEF domain containing G7; pleckstrin homology domain containing, family G (with RhoGef domain) member 7; pleckstrin homology domain-containing family G member 7; PLEKHG7
Common Name PLEKHG7
Gene Symbol PLEKHG7
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IKEGGSCTVLDQPIPLDRLVVKSIEPLHVSVFGLRNAFLIQHENRYRQCIAAFLLQAQTENIKKTWMAQITTAISCFTKSQETKKI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less