missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human P-Selectin (aa 382-522) Control Fragment Recombinant Protein

Catalog No. RP99386
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP99386 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP99386 Supplier Invitrogen™ Supplier No. RP99386
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

P-selectin (Selectin P, GMP-140, LECAM3, CD62 antigen-like family member) is a 140 kDa type 1 transmembrane glycoprotein, and is one of the most commonly studied proteins that regulate cell rolling. P-selectin is stored in the Weibel-Palade bodies of endothelial cells, as well as in a-granules of platelets. From there, it can be rapidly brought to the cell surface after exposure to thrombin, histamine, complement 5a, Ca21 ionophores, or adenosine diphosphate. P-selectin protein redistributes to the plasma membrane during platelet activation and degranulation and mediates the interaction of activated endothelial cells or platelets with leukocytes. P-selectin plays an important role in adhesive processes between leucocytes and endothelial cells, and is a calcium dependent receptor that binds to sialylated forms of Lewis blood group carbohydrate antigens found on neutrophils and monocytes. P-selectin is constitutively expressed in inflammation and contributes to atherogenesis, thrombosis and tissue destruction. Clinically, P-selectin is used to distinguish heparin induced thrombocytopenia with and without thrombosis.

Specifications

Accession Number P16109
Concentration 1.7 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 6403
Name Human P-Selectin (aa 382-522) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias CD62; CD62 antigen-like family member P; CD62P; CD62P antigen; CD62P; CD62 homolog; FLJ45155; GMP140; GMP-140; GMRP; Granule membrane protein 140; granule membrane protein 140kDa; granulocyte membrane protein; Grmp; LECAM3; leukocyte-endothelial cell adhesion molecule 3; PADGEM; Platelet activation dependent granule-external membrane protein; platelet alpha-granule membrane protein; PSEL; PSELECT; P-selectin; P-selectin precursor; RP1-86F14.2; selectin P; selectin P (granule membrane protein 140kDa, antigen CD62); selectin, platelet; Selp
Common Name P-Selectin (CD62P)
Gene Symbol SELP
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFMLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNEGLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less