missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP100023

Invitrogen™ Human NAPSA Control Fragment Recombinant Protein

Catalog No. RP100023
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP100023 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP100023 Supplier Invitrogen™ Supplier No. RP100023
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61472. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Napsin 1 is an aspartic protease that is generally expressed in the lung, but also present in kidney and in metastatic carcinomas throughout the body. Napsin 1 processes surfactant protein B in healthy pulmonary and renal tissues, but is abnormally regulated when carcinogenesis occurs. Thus, many researchers have found napsin evaluation to be useful in identifying several cancers, and differentiating primary tumors from metastases. When combined with thyroid transcription factor analysis, napsin can be used as a specific biomarker for differentiation of carcinoma types. Napsin has also been associated with pulmonary alveolar proteinosis as well as in protein catabolism in renal tubules.

Specifications

Accession Number O96009
Concentration 2.5 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 9476
Name Human NAPSA Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias asp 4; ASP4; Aspartyl protease 4; KAP; Kdap; KDAP-1; kidney-derived aspartic protease-like protein; Nap; NAP1; NAPA; Napsa; napsin A aspartic peptidase; napsin-1; Napsin-A; pronapsin; pronapsin A; SNAPA; TA01/TA02
Common Name NAPSA
Gene Symbol NAPSA
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DGILGLGFPILSVEGVRPPLDVLVEQGLLDKPVFSF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less