missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP95213

Invitrogen™ Human PDK1 (aa 92-151) Control Fragment Recombinant Protein

Catalog No. RP95213
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95213 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95213 Supplier Invitrogen™ Supplier No. RP95213
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82971. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PDK1 (pyruvate dehydrogenase kinase, isozyme 1) gene, located on chromosome 2q31.1, encodes a member of the pyruvate dehydrogenase kinase family. This kinase plays a crucial role in the regulation of glucose metabolism by phosphorylating and inactivating the pyruvate dehydrogenase complex (PDC), which converts pyruvate to acetyl-CoA, linking glycolysis to the Krebs cycle. Structurally, the PDK1 protein contains a kinase domain that is essential for its enzymatic activity. PDK1 acts as a gatekeeper of glucose oxidation and is tightly regulated by various metabolic signals, including insulin and hypoxia. Dysregulation of PDK1 activity has been implicated in metabolic disorders such as diabetes and cancer, where it contributes to altered cellular energy homeostasis and metabolic reprogramming.

Specifications

Accession Number Q15118
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 5163
Name Human PDK1 (aa 92-151) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial; [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1, mitochondrial; B830012B01; D530020C15Rik; isoenzyme 1; kinase isoenzyme 1; lipoamide; mitochondrial pyruvate dehydrogenase, lipoamide, kinase isoenzyme 1; PDH kinase 1; PDHK1; PDK p48; Pdk1; pyruvate dehydrogenase; pyruvate dehydrogenase kinase 1; Pyruvate dehydrogenase kinase isoform 1; pyruvate dehydrogenase kinase, isoenzyme 1; pyruvate dehydrogenase kinase, isozyme 1
Common Name PDK1
Gene Symbol PDK1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHND
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less