Learn More
Invitrogen™ Human MXRA7 (aa 125-199) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100589
Description
Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60840 (PA5-60840. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Specifications
P84157 | |
Blocking Assay, Control | |
439921 | |
100 ÎĽL | |
1810057P16Rik; E130302J09Rik; HBV PreS1-transactivated protein 1; matrix remodeling associated 7; matrix remodelling associated 7; matrix-remodeling-associated protein 7; matrix-remodelling associated 7; Mxra7; PS1TP1; TMAP1; transmembrane anchor protein 1 | |
MXRA7 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human MXRA7 (aa 125-199) Control Fragment | |
RUO | |
MXRA7 | |
Unconjugated | |
Recombinant | |
GPSSEGPEEEDGEGFSFKYSPGKLRGNQYKKMMTKEELEEEQRVQKEQLAAIFKLMKDNKETFGEMSDGDVQEQL | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |