Learn More
Invitrogen™ Human DAP Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP92025
Description
Highest antigen sequence indentity to the following orthologs: Mouse (27%), Rat (27%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83090 (PA5-83090. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a basic, proline-rich, 15-kD protein. The protein acts as a positive mediator of programmed cell death that is induced by interferon-gamma.Spécifications
P51397 | |
Blocking Assay, Control | |
1611 | |
100 μL | |
4921531N22Rik; AI789753; amylin peptide; AU040360; DAP; DAP 1; DAP1; DAP-1; death associated protein; death-associated protein; death-associated protein 1; MGC99796; OTTHUMP00000161670; OTTHUMP00000221331; Rap7a | |
DAP | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human DAP Control Fragment | |
RUO | |
DAP | |
Unconjugated | |
Recombinant | |
QFRPNPTLLGNLRQNQVLCPLPYISIFKTRNSSSPNLVYGESGWMSFEDHCAPRGAISRICQDPRKILALVLFQQSP | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |