Learn More
Invitrogen™ Human Carabin (aa 8-70) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP104208
Description
Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84823 (PA5-84823. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Carabin is an endogenous inhibitor of calcineurin (see MIM 114105) that also inhibits the Ras (see MIM 190020) signaling pathway through its intrinsic Ras GTPase-activating protein activity (Pan et al., 2007 [PubMed 17230191]).- Environmental benefits include:
- Énergie renouvelable
Spécifications
Q8IV04 | |
Blocking Assay, Control | |
374403 | |
100 μL | |
1810062O14Rik; AI428527; CARABIN; EBP50-PDZ interactor of 64 kD; EPI64C; TBC1 domain family member 10 C; TBC1 domain family, member 10 c; TBC1D10C | |
TBC1D10C | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human Carabin (aa 8-70) Control Fragment | |
RUO | |
Carabin | |
Unconjugated | |
Recombinant | |
DLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEPGPGHPPADLIRQREMKWVEM | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |