missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP91879

Invitrogen™ Human RUVBL1 (aa 70-149) Control Fragment Recombinant Protein

Catalog No. RP91879
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91879 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91879 Supplier Invitrogen™ Supplier No. RP91879
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110857 (PA5-110857. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It may attenuate protein kinase C activity by regulating diacylglycerol levels in intracellular signaling cascade and signal transduction. Alternative splicing occurs at this locus and four transcript variants encoding distinct isoforms have been identified.

Specifications

Accession Number Q9Y265
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8607
Name Human RUVBL1 (aa 70-149) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2510009G06Rik; 49 kDa TATA box-binding protein-interacting protein; 49 kDa TBP-interacting protein; 54 kDa erythrocyte cytosolic protein; DNA helicase p50; ECP54; ECP-54; INO80 complex subunit H; INO80H; NMP 238; NMP238; Nuclear matrix protein 238; PONTIN; Pontin 52; Pontin52; RuvB (E coli homolog)-like 1; RuvB like AAA ATPase 1; Ruvbl1; ruvB-like 1; RuvB-like AAA ATPase 1; RuvB-like protein 1; RVB1; TAP54-alpha; TATA binding protein interacting protein 49 kDa; TIH1; Tip49; TIP49A; TIP60-a; TIP60-associated protein 54-alpha
Common Name RUVBL1
Gene Symbol RUVBL1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less