missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP91137

Invitrogen™ Human Aquaporin 1 (aa 233-269) Control Fragment Recombinant Protein

Catalog No. RP91137
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91137 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91137 Supplier Invitrogen™ Supplier No. RP91137
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53954 (PA5-53954. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Aquaporin 1 is a 28kD integral membrane protein which was originally identified in red blood cells and renal proximal tubules. AQP1 is also expressed by the choroid plexus and various other tissues. It forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.

Specifications

Accession Number P29972
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 358
Name Human Aquaporin 1 (aa 233-269) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AQP 1; AQP CHIP; Aqp1; AQP-1; AQP-CHIP; aquaporin 1; Aquaporin 1 (aquaporin channel forming integral protein 28 (CHIP)); aquaporin 1 (channel-forming integral protein, 28 kDa, CO blood group); aquaporin 1 (Colton blood group); aquaporin 1, Colton blood group antigen; Aquaporin CHIP; Aquaporin1; aquaporin-1; Aquaporin-CHIP; channel-like integral membrane protein, 28-kDa; CHIP 28; CHIP28; CO; Colton blood group; Delayed early response protein 2; DER2; growth factor-induced delayed early response protein; membrane channel; MGC26324; urine water channel; Water channel protein for red blood cells and kidney proximal tubule
Common Name Aquaporin 1
Gene Symbol Aqp1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less