missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP96674

Invitrogen™ Human ATP10D (aa 1324-1421) Control Fragment Recombinant Protein

Catalog No. RP96674
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96674 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96674 Supplier Invitrogen™ Supplier No. RP96674
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (26%), Rat (26%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62245 (PA5-62245. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalytic component of a P4-ATPase flippase complex which catalyzes the hydrolysis of ATP coupled to the transport of aminophospholipids from the outer to the inner leaflet of various membranes and ensures the maintenance of asymmetric distribution of phospholipids. Phospholipid translocation seems also to be implicated in vesicle formation and in uptake of lipid signaling molecules (Probable). [UniProt]

Specifications

Accession Number Q9P241
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57205
Name Human ATP10D (aa 1324-1421) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9830145H18Rik; Atp10d; ATPase class V type 10 D; ATPase phospholipid transporting 10 D; ATPase phospholipid transporting 10 D (putative); ATPase, class V, type 10 D; ATPVD; D5Buc24e; KIAA1487; P4-ATPase flippase complex alpha subunit ATP10D; probable phospholipid-transporting ATPase VD; putative type IV aminophospholipid transporting ATPase; si:dkey-20i10.6; type IV aminophospholipid transporting ATPase
Common Name ATP10D
Gene Symbol ATP10D
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LFPSPILRAKHFDRLTPEERTKALKKWRGAGKMNQVTSKYANQSAGKSGRRPMPGPSAVFAMKSASSCAIEQGNLSLCETALDQGYSETKAFEMAGPS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less