missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP92232

Invitrogen™ Human ASMTL (aa 337-480) Control Fragment Recombinant Protein

Catalog No. RP92232
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP92232 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP92232 Supplier Invitrogen™ Supplier No. RP92232
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (38%), Rat (38%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54530 (PA5-54530. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene has an N-terminus that is similar to the multicopy associated filamentation (maf) protein of Bacillus subtilis and to orfE of Escherichia coli, while the C-terminus is similar to N-acetylserotonin O-methyltransferase. This gene is located in the pseudoautosomal region 1 (PAR1) of X and Y chromosomes. Three transcript variants encoding different isoforms have been found for this gene.

Specifications

Accession Number O95671
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8623
Name Human ASMTL (aa 337-480) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias acetylserotonin N-methyltransferase-like; acetylserotonin O-methyltransferase-like; ASMTL; ASMTLX; ASMTLY; ASTML; dTTP/UTP pyrophosphatase; dTTPase/UTPase; N-acetylserotonin O-methyltransferase-like protein; Nucleoside triphosphate pyrophosphatase; Nucleotide PPase; Nucleotide pyrophosphatase; Probable bifunctional dTTP/UTP pyrophosphatase/methyltransferase protein
Common Name ASMTL
Gene Symbol ASMTL
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RLLDICAAMGLLEKTEQGYSNTETANVYLASDGEYSLHGFIMHNNDLTWNLFTYLEFAIREGTNQHHRALGKKAEDLFQDAYYQSPETRLRFMRAMHGMTKLTACQVATAFNLSRFSSACDVGGCTGALARELAREYPRMQVTV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less