missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP109000

Invitrogen™ Human SKA3 (aa 327-412) Control Fragment Recombinant Protein

Catalog No. RP109000
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109000 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109000 Supplier Invitrogen™ Supplier No. RP109000
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (45%), Rat (45%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139853 (PA5-139853. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Upon entry into mitosis, the cell's microtubule (MT) network forms the mitotic spindle, allowing the segregation of paired chromosomes. Proteinaceous structures on centromeric chromatin termed kinetochores (KT) are essential for the proper attachment of the chromosomes to the spindle MTs. A recently discovered spindle and kinetochore complex, comprised of proteins SKA1, SKA2, and SKA3, has been found to be required for stable KT-MT interactions and timely anaphase onset. Like with SKA1 or SKA2, depletion of SKA3 by siRNA delays anaphase transition, resulting in a prolonged a metaphase-like state. These SKA3-depleted cells accumulate high levels of the checkpoint protein Bub1 at kinetochores, suggesting the SKA complex plays a key role in spindle checkpoint silencing and the maintenance of chromosome cohesion in mitosis.

Specifications

Accession Number Q8IX90
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 221150
Name Human SKA3 (aa 327-412) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C13orf3; F630043A04Rik; RAMA1; RGD1307201; RP11-101P17.12-002; Ska3; spindle and kinetochore associated complex subunit 3; spindle and kinetochore-associated protein 3
Common Name SKA3
Gene Symbol SKA3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RTSLVLNSDTCFENLTDPSSPTISSYENLLRTPTPPEVTKIPEDILQLLSKYNSNLATPIAIKAVPPSKRFLKHGQNIRDVSNKEN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less