missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ATG3 (aa 9-144) Control Fragment Recombinant Protein

Catalog No. RP102893
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP102893 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP102893 Supplier Invitrogen™ Supplier No. RP102893
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATG3 (APG3) is a widely expressed conjugating enzyme for APG8 lipidation, an essential step for the initiation of autophagy. Autophagy, the process of bulk degradation of cellular proteins through an autophagosomic-lysosomal pathway is important for normal growth control and may be defective in tumor cells. Autophagy is involved in the preservation of cellular nutrients under starvation conditions as well as the normal turnover of cytosolic components. This process is negatively regulated by TOR (Target of rapamycin) through phosphorylation of autophagy protein APG1. ATG3 functions as an E2-like enzyme during the initial stages of autophagosome formation by catalyzing the formation of the Atg8-phosphatidylethanolamine (Atg8-PE) conjugate, which is critical for autophagy.

Specifications

Accession Number Q9NT62
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 64422
Name Human ATG3 (aa 9-144) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610016C12Rik; APG3; Apg3l; APG3-like; Apg3p; atg3; ATG3 autophagy related 3 homolog; atg3.S; Atg3l; autophagy related 3; autophagy related 3 S homeolog; autophagy-related 3; autophagy-related protein 3; DKFZp564M1178; EGK_11288; FLJ22125; hApg3; MGC15201; PC3-96; Pig1; PIG-1; preconditioning-inducible gene 1 protein; Protein PC3-96; Ubiquitin-like-conjugating enzyme ATG3; XELAEV_18014721mg
Common Name ATG3
Gene Symbol ATG3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less