missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP89333

Invitrogen™ Human TAF12 (aa 11-156) Control Fragment Recombinant Protein

Catalog No. RP89333
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89333 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89333 Supplier Invitrogen™ Supplier No. RP89333
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52572 (PA5-52572. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TAF12 is involved in the control of transcription by RNA polymerase II involves the basal transcription machinery which is a collection of proteins. These proteins with RNA polymerase II, assemble into complexes which are modulated by transactivator proteins that bind to cis-regulatory elements located adjacent to the transcription start site. Some modulators interact directly with the basal complex, whereas others may act as bridging proteins linking transactivators to the basal transcription factors. Some of these associated factors are weakly attached while others are tightly associated with TBP in the TFIID complex. Among the latter are the TAF proteins. Different TAFs are predicted to mediate the function of distinct transcriptional activators for a variety of gene promoters and RNA polymerases. TAF12 interacts directly with TBP as well as with TAF2I.

Specifications

Accession Number Q16514
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6883
Name Human TAF12 (aa 11-156) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 20 kDa; 2810422D08Rik; AW557038; hypothetical protein LOC614227; TAF12; TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor; TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20 kD; TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20 kDa; TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20 kDa; TAF15; TAF2J; TAFII20; TAFII-20; TAFII20/TAFII15; TAFII-20/TAFII-15; TATA box binding protein (TBP)-associated factor, RNA polymerase II, J, 20 kD; TATA box binding protein associated factor 12; TATA-box binding protein associated factor 12; TATA-box binding protein associated factor 12; transcription initiation factor TFIID subunit 12; transcription initiation factor TFIID 20 kDa subunits; Transcription initiation factor TFIID 20/15 kDa subunits; transcription initiation factor TFIID subunit 12
Common Name TAF12
Gene Symbol TAF12
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less