missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP102866

Invitrogen™ Human BANF1 (aa 1-80) Control Fragment Recombinant Protein

Catalog No. RP102866
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP102866 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP102866 Supplier Invitrogen™ Supplier No. RP102866
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58710 (PA5-58710. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Barrier-to-autointegration factor 1 (BANF1) is a conserved chromatin protein that non-specifically binds double-stranded DNA. BANF1 also interacts with a family of nuclear proteins that include LAP2, emerin, and MAN1. It is also a host cell component of retroviral pre-integration complexes (PICs), including that of HIV. BANF1 will bind to p55 Gag (the structural precursor of HIV-1 virions) as well as its cleaved product matrix. In addition to being a host cell component of the PIC, it is thought that BANF1 is also present at low levels in incoming virions, and thus might contribute to the assembly or activity of HIV-1 PICs through direct binding to matrix as well as DNA.

Specifications

Accession Number O75531
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8815
Name Human BANF1 (aa 1-80) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Baf; Banf1; barrier to autointegration factor 1; barrier-to-autointegration factor; Barrier-to-autointegration factor, N-terminally processed; BCRG1; Bcrp1; breakpoint cluster region protein 1; Breakpoint cluster region protein, uterine leiomyoma, 1; Breakpoint cluster region protein, uterine leiomyoma, 1; barrier to autointegration factor; D14S1460; L2bp1; L2bp1/Baf; Lap2 binding protein 1; LAP2-binding protein 1; NGPS
Common Name BANF1
Gene Symbol BANF1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less