missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP96670

Invitrogen™ Human SLC39A8 (aa 220-292) Control Fragment Recombinant Protein

Catalog No. RP96670
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96670 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96670 Supplier Invitrogen™ Supplier No. RP96670
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The zinc transporter ZIP8, also known as SLC39A9, is a member of a family of divalent ion transporters. Zinc is an essential ion for cells and plays significant roles in the growth, development, and differentiation. The zinc transporter family is divided into four subfamilies (I, II, LIV-1 and gufA). ZIP8 is glycosylated and located at the plasma membrane and mitochondria. It has been identified as the transporter responsible for transport of the toxic Cadmium cation. ZIP8 has also been suggested to play a role in the regulation of interferon-gamma expression in activated human T cells.

Specifications

Accession Number Q9C0K1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 64116
Name Human SLC39A8 (aa 220-292) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4933419D20Rik; AA986696; BCG induced integral membrane protein BIGM103; BCG-induced integral membrane protein in monocyte clone 103 protein; BIGM103; CDG2N; LIV-1 subfamily of ZIP zinc transporter 6; LZT-Hs6; PP3105; Slc39a8; solute carrier family 39 (metal ion transporter), member 8; solute carrier family 39 (zinc transporter), member 8; solute carrier family 39 (zinc transporter), member 8 tv2; solute carrier family 39 member 8; Zinc transporter ZIP8; Zip8; ZIP-8; Zrt- and Irt-like protein 8
Common Name SLC39A8
Gene Symbol Slc39a8
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LKTYGQNGHTHFGNDNFGPQEKTHQPKALPAINGVTCYANPAVTEANGHIHFDNVSVVSLQDGKKEPSSCTCL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less