missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PIAS2 (aa 427-470) Control Fragment Recombinant Protein

Catalog No. RP110105
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP110105 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP110105 Supplier Invitrogen™ Supplier No. RP110105
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145166 (PA5-145166. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein involved in the regulation of transcription factors involved in MAP kinase signaling. The symbol MIZ1 has also been associated with ZBTB17 which is a different gene located on chromosome 1. Two alternatively spliced transcripts encoding different isoforms have been described.

Specifications

Accession Number O75928
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9063
Name Human PIAS2 (aa 427-470) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6330408K17Rik; AI462206; androgen receptor-interacting protein 3; ARIP3; AU018068; DAB2-interacting protein; Dib; DIP; E3 SUMO-protein ligase PIAS2; E3 SUMO-protein transferase PIAS2; MGC102682; MIZ; Miz1; Msx-interacting zinc finger protein; Msx-interacting-zinc finger; msx-interacting-zinc finger protein; Pias2; PIAS-NY protein; Piasx; PIASxalpha; PIASX-ALPHA; PIASxalpha6; PIASxb; PIASxbeta; PIASX-BETA; protein inhibitor of activated STAT 2; protein inhibitor of activated STAT x; protein inhibitor of activated STAT, 2; Protein inhibitor of activated STAT2; RING-type E3 ubiquitin transferase PIAS2; SIZ2; zinc finger, MIZ-type containing 4; ZMIZ4
Common Name PIAS2
Gene Symbol Pias2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MRPKKEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less