missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP89728

Invitrogen™ Human FAM198B (aa 32-167) Control Fragment Recombinant Protein

Catalog No. RP89728
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89728 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89728 Supplier Invitrogen™ Supplier No. RP89728
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52406 (PA5-52406. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FAM198B is a protein coding gene.

Specifications

Accession Number Q6UWH4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51313
Name Human FAM198B (aa 32-167) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110032E23Rik; 2210419I08Rik; AD021; AD036; AV011458; C4orf18; Ened; Expressed in nerve and epithelium during development; FAM198B; family with sequence similarity 198 member B; family with sequence similarity 198, member B; gask1b; GaskbB; golgi associated kinase 1 B; Golgi-associated kinase 1 B; LOW QUALITY PROTEIN: protein FAM198B; protein ENED; protein ENED; protein FAM198B; protein FAM198B; UNQ2512/PRO6001
Common Name FAM198B
Gene Symbol FAM198B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PRTRRNLLLGTACAIYLGFLVSQVGRASLQHGQAAEKGPHRSRDTAEPSFPEIPLDGTLAPPESQGNGSTLQPNVVYITLRSKRSKPANIRGTVKPKRRKKHAVASAAPGQEALVGPSLQPQEAAREADAVAPGYA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less