Abnova Corporation

1 – 15 of 13,773 results

Abnova™ Human S1PR4 Full-length ORF (NP_003766.1) Recombinant Protein without tag

Used for AP, Func, Screening

Pricing and Availability

GPC3 Mouse anti-Human, Clone: SPM595, Abnova™

Mouse monoclonal antibody raised against partial recombinant human GPC3.

Pricing and Availability

Abnova™ Human CD274 Full-length ORF (ADR82905.1) Recombinant Protein without tag

Used for AP, Func, Screening

Pricing and Availability

Abnova™ Human S1PR3 Full-length ORF (NP_005217.2) Recombinant Protein without tag

Used for AP, Func, Screening

Pricing and Availability

EPCAM Mouse anti-Human, Rat, Clone: EGP40/1110, Abnova™

Mouse monoclonal antibody raised against partial recombinant human EPCAM.

Pricing and Availability

Abnova™ Human CCR8 Full-length ORF (NP_005192.1, 1 a.a. - 355 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing and Availability

IgG (H, L) Chicken anti-Cotton Rat, HRP, Polyclonal , Abnova™

Chicken polyclonal antibody raised against cotton rat IgG (H&L).

Pricing and Availability

Abnova™ Human DRD2 Full-length ORF (ABM82846.1) Recombinant Protein without tag

Used for AP, Func, Screening

Pricing and Availability

Abnova™ Jak/Stat Phospho-Specific Array

Jak/Stat Phospho-Specific Array includes 42 highly specific and well-characterized phosphorylation antibodies in the Jak/Stat pathway.

Pricing and Availability

Abnova™ Ovalbumin (Egg White)

Used for SDS-PAGE

Pricing and Availability

Abnova™ Human ROMO1 Full-length ORF (ADZ15662.1, 1 a.a. - 79 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing and Availability

Abnova™ Human STAT1 Full-length ORF (AAH02704.1, 1 a.a. - 712 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing and Availability
Specifications

Form	Liquid
Common Name	STAT1
Molecular Weight (g/mol)	109.4kDa
Gene Symbol	STAT1
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,Protein Array,ELISA,Western Blot
Name	STAT1 (Human) Recombinant Protein (P01)
Accession Number	AAH02704.1
Regulatory Status	RUO
Purification Method	Glutathione Sepharose 4 Fast Flow
Gene Alias	DKFZp686B04100/ISGF-3/STAT91
Gene ID (Entrez)	6772
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen	MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWKRRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQVLWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKVKVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTNEGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAEPRNLSFFLTPPCARWAQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNASPDGLIPWTRFCKENINDKNFPFWLWIESILELIKKHLLPLWNDGCIMGFISKERERALLKDQQPGTFLLRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEV
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ Human TXNL1 (NP_004777, 1 a.a. - 289 a.a.) Full-length Recombinant Protein with His tag

Used for SDS-PAGE

Pricing and Availability

Abnova™ Human YAP1 Partial ORF (NP_006097, 53 a.a. - 161 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Pricing and Availability
Specifications

Form	Liquid
Common Name	YAP1
Molecular Weight (g/mol)	37.73kDa
Gene Symbol	YAP1
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Expression System	wheat germ expression system
For Use With (Application)	Antibody Production,Protein Array,ELISA,Western Blot
Name	YAP1 (Human) Recombinant Protein (Q01)
Accession Number	NP_006097
Regulatory Status	RUO
Gene Alias	YAP/YAP2/YAP65/YKI
Gene ID (Entrez)	10413
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Immunogen	QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Protein Tag	GST
Species	Wheat Germ (in vitro)
Recombinant	Recombinant

Abnova™ SLC25A27 (Human) Recombinant Protein

Human SLC25A27 full-length ORF ( AAH33091, 1 a.a. - 245 a.a.) recombinant protein with GST-tag at N-terminal.

Pricing and Availability

Narrow Results

Your choices regarding cookies on this site

Filtered Search Results