missing translation for 'onlineSavingsMsg'
Learn More

sex comb on midleg homolog 1 (Drosophila), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SCMH1.

Supplier: Abnova Corporation H00022955A01

Catalog No. 89-004-551

Quantity

Description

Sequence: EKLCHNLRSDNLFGNQPFTQTHLSLTAIEYSHSHDRYLPGETFVLGNSLARSLEPHSDSMDSASNPTNLVSTSQRHRPLLSSCGLPPSTASAVRRLCSR

Specifications

Antigen	sex comb on midleg homolog 1 (Drosophila)
Classification	Polyclonal
Description	Mouse polyclonal antibody raised against a partial recombinant SCMH1.
Gene	SCMH1
Gene Alias	Scml3
Host Species	Mouse
Quantity	50 μL
Whole Molecule	Yes
Gene ID (Entrez)	22955
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Applications	ELISA, Western Blot
Conjugate	Unconjugated
Formulation	50% glycerol
Gene Accession No.	NM_012236
Gene Symbols	SCMH1
Immunogen	SCMH1 (NP_036368, 404 a.a. ∼ 502 a.a) partial recombinant protein with GST tag.
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Serum

Product Suggestions

Description