missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human TEF1 (aa 131-198) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP105067
Description
Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66077 (PA5-66077. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
TEF1 (Transcriptional enhancer factor 1), a member of the TEA/ATTS domain family, is a nuclear protein that is expressed in numerous cell types and plays a role in controlling the expression of numerous genes. TEF family members have a highly conserved DNA-binding domain TEF-1 binds to GT-IIC, SphI/II and M-CAT. TEF-1 also binds to the proximal regulatory element (PRE) of transforming growth factor-alpha, a member of the EGF family that is overexpressed in many types of cancer. Furthermore, TEF-1 represses transcription in placental cells. In vitro, TEF-1 is phosphorylated by several PKC isozymes. TEF-1 is phosphorylated in vivo at serine and threonine residues. Phosphorylation of TEF-1, both in vivo and in vitro, results in a reduction in its DNA-binding capability, which suggests a potential role for TEF-1 in PKC inhibition. TEF-1 also complexes with larger tumor antigen (TAg), and may thus have a role in tumorigenesis. Dimerization of TEF-1 may be important for TEF-1 to function as a regulator of gene transcription.Spécifications
| P28347 | |
| Blocking Assay, Control | |
| 7003 | |
| 100 μL | |
| 2610024B07Rik; AA; B230114H05Rik; Gtrgeo5; mTEF-1; N TEAD1; NTEF1; NTEF-1; protein GT-IIC; REF1; Tcf13; TCF-13; TEA domain family member 1; TEA domain family member 1 (SV40 transcriptional enhancer factor); TEA domain transcription factor 1; TEAD1; TEAD-1; TEF1; TEF-1; Transcription factor 13; transcriptional enhancer factor 1; transcriptional enhancer factor TEF-1 | |
| Tead1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human TEF1 (aa 131-198) Control Fragment | |
| RUO | |
| TEF1 | |
| Unconjugated | |
| Recombinant | |
| VSATAIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASA | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |