missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human SPSB2 (aa 1-69) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100060
Description
Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63089 (PA5-63089. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a member of a subfamily of proteins containing a central SPRY (repeats in splA and RyR) domain and a C-terminal suppressor of cytokine signaling (SOCS) box. This protein plays a role in cell signaling. This gene is present in a gene-rich cluster on chromosome 12p13 in the vicinity of the CD4 antigen and triosephosphate isomerase genes. Alternative splicing results in multiple transcript variants.Spécifications
| Q99619 | |
| Blocking Assay, Control | |
| 84727 | |
| 100 μL | |
| AI461677; C9; gene rich cluster, C9 gene protein; gene-rich cluster protein C9; Grcc9; splA/ryanodine receptor domain and SOCS box containing 2; SPRY domain-containing SOCS box protein 2; SPRY domain-containing SOCS box protein SSB-2; Spsb2; SSB2; SSB-2 | |
| SPSB2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human SPSB2 (aa 1-69) Control Fragment | |
| RUO | |
| SPSB2 | |
| Unconjugated | |
| Recombinant | |
| MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERR | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |