missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human PLD5 (aa 455-536) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP94481
Description
Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55834 (PA5-55834. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The specific function of the protein remains unknown.Spécifications
| Q8N7P1 | |
| Blocking Assay, Control | |
| 200150 | |
| 100 μL | |
| Inactive choline phosphatase 5; inactive phosphatidylcholine-hydrolyzing phospholipase D5; Inactive phospholipase D5; inactive PLD 5; phospholipase D family member 5; phospholipase D family, member 5; PLD5; PLDc | |
| PLD5 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human PLD5 (aa 455-536) Control Fragment | |
| RUO | |
| PLD5 | |
| Unconjugated | |
| Recombinant | |
| DWVGNDFTQNAGTGLVINQADVRNNRSIIKQLKDVFERDWYSPYAKTLQPTKQPNCSSLFKLKPLSNKTATDDTGGKDPRNV | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |