missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human LCN15 Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP101526
Description
Highest antigen sequence indentity to the following orthologs: Mouse (34%), Rat (34%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63882 (PA5-63882. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Spécifications
| Q6UWW0 | |
| Blocking Assay, Control | |
| 389812 | |
| 100 μL | |
| LCN15; lipocalin 15; lipocalin-15; MSFL2541; PRO6093; UNQ2541; UNQ2541/PRO6093 | |
| LCN15 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human LCN15 Control Fragment | |
| RUO | |
| LCN15 | |
| Unconjugated | |
| Recombinant | |
| FAVLYIYKELEGALSTMVQLYSRTQDVSPQALKAFQDFYPTLGLPEDMMVMLPQSDACNPESKE | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |