missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human GABBR1 (aa 379-456) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100046
Description
Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Receptor for GABA. The activity of this receptor is mediated by G-proteins that inhibit adenylyl cyclase activity, stimulates phospholipase A2, activates potassium channels, inactivates voltage-dependent calcium-channels and modulates inositol phospholipids hydrolysis. Plays a critical role in the fine-tuning of inhibitory synaptic transmission. Pre-synaptic GABA-B-R inhibit neurotransmitter release by down-regulating high-voltage activated calcium channels, whereas postsynaptic GABA-B-R decrease neuronal excitability by activating a prominent inwardly rectifying potassium (Kir) conductance that underlies the late inhibitory postsynaptic potentials. Not only implicated in synaptic inhibition but also in hippocampal long-term potentiation, slow wave sleep, muscle relaxation and antinociception.Spécifications
| Q9UBS5 | |
| Blocking Assay, Control | |
| 2550 | |
| 100 μL | |
| bM573K1.1; bM573K1.1.1 (gamma-aminobutyric acid (GABA) B receptor, 1 A); DAAP-188P13.3; dJ271M21.1.1; dJ271M21.1.2; FLJ92613; GABA(B) receptor; GABAB; GABA-B receptor 1; GABA-B receptor, R1 subunit; GABAB1; Gaba-b1; GABAbR1; GABA-BR1; GABA-B-R1; Gababr1 receptor; Gaba-b-r1a; Gaba-br1a receptor; GABA-BR1b receptor; Gabbr1; GABBR1-3; gamma-aminobutyric acid; gamma-aminobutyric acid (GABA) B receptor 1; gamma-aminobutyric acid (GABA) B receptor, 1; gamma-aminobutyric acid (GABA-B) receptor, 1; gamma-aminobutyric acid type B receptor subunit 1; GB1; GBR1; GPRC3A; HGB1a; OTTHUMP00000109099; OTTHUMP00000214725; seven transmembrane helix receptor | |
| GABBR1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human GABBR1 (aa 379-456) Control Fragment | |
| RUO | |
| GABBR1 | |
| Unconjugated | |
| Recombinant | |
| YKERLFGKKYVWFLIGWYADNWFKIYDPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKR | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |