missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human FGFBP3 (aa 32-63) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP101501
Description
Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62879 (PA5-62879. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
FGFBP3 is a heparin-binding protein which binds to FGF2, prevents binding of FGF2 to heparin and probably inhibits immobilization of FGF2 on extracellular matrix glycosaminoglycans, allowing its release and subsequent activation of FGFR signaling which leads to increased vascular permeability.Spécifications
| Q8TAT2 | |
| Blocking Assay, Control | |
| 143282 | |
| 100 μL | |
| 2610306H15Rik; C10orf13; FGF-binding protein 3; Fgfbp3; Fgf-bp3; FGFBP-3; fibroblast growth factor binding protein 3; fibroblast growth factor-binding protein 3; PSEC0101 | |
| FGFBP3 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human FGFBP3 (aa 32-63) Control Fragment | |
| RUO | |
| FGFBP3 | |
| Unconjugated | |
| Recombinant | |
| AASNVAEPVPGPTGGSSGRFLSPEQHACSWQL | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |