missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human CUEDC2 (aa 208-287) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP106018
Description
Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65315 (PA5-65315. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The CUE (coupling of ubiquitin conjugation to endoplasmic reticulum degradation) domain is an evolutionarily conserved, approximately 40 amino acid monoubiquitin-binding domain that mediates intramolecular monoubiquitylation. CUE domains are present in eukaryotic proteins that are involved in ubiquitination and protein trafficking pathways and may be required for ubiquitination of the proteins in which they are found. CUEDC2 (CUE domain-containing protein 2) was found through a yeast two-hybrid screening as a protein that interacts with the progesterone receptor (PR) and promotes progesterone-induced PR degradation by the ubiquitin-proteasome pathway. CUEDC2 also decreases the sumoylation of PR. CUEDC2 has also been found to interact with IKK-alpha and IKK-beta and decrease the activation of NF-kappa-B by decreasing the activation of IKK.Spécifications
| Q9H467 | |
| Blocking Assay, Control | |
| 79004 | |
| 100 μL | |
| 3010002G01Rik; bA18I14.5; C10orf66; CUE domain containing 2; CUE domain-containing protein 2; CUEDC2; HOYS6; Unknown (protein for MGC:128745) | |
| CUEDC2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human CUEDC2 (aa 208-287) Control Fragment | |
| RUO | |
| CUEDC2 | |
| Unconjugated | |
| Recombinant | |
| QKDELKSFILQKYMMVDSAEDQKIHRPMAPKEAPKKLIRYIDNQVVSTKGERFKDVRNPEAEEMKATYINLKPARKYRFH | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |